KEGG   Burkholderia cenocepacia DWS 37E-2: DM40_362Help
Entry
DM40_362          CDS       T03488                                 

Definition
(GenBank) alpha/beta hydrolase fold family protein
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
bcew  Burkholderia cenocepacia DWS 37E-2
Pathway
bcew00903  Limonene and pinene degradation
bcew00930  Caprolactam degradation
bcew01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bcew00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    DM40_362
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    DM40_362
Enzymes [BR:bcew01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     DM40_362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 Abhydrolase_2
Motif
Other DBs
NCBI-ProteinID: AIO41343
Position
1:complement(398444..399406)
Genome map
AA seq 320 aa AA seqDB search
MSWQSKFACWLLRWQFRPETMRPVLDPARARRFTDLRMVIPRRVPSGYRLRECYGPGDAP
LRGEWLERTGAVAARGAGRTLLYFHGGGYYFCSTKTHRPLVFRLTRRAGVRSFSLDYRLA
PENRFPAALDDALAAYRQLLALGTPPESIVFGGDSAGGGLALATLVALRDRGEPLPAGAI
LFSPWTDLAGTGDTMRTNDGRDPMFSAAALPKAAKLYLGDAPATHPYASPLYADLAGLPP
LFIQAGSTEVLLDDARRVADNAKAAGVPVELEVWPDMPHVWQLYTPMVPESRDALDRAAA
FLRRVAVERAIQRAGEPSIA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgagttggcaaagcaagttcgcgtgctggctgctgcgctggcagtttcgtccggagacc
atgcgcccggtgctcgaccccgcccgcgcgcggcgcttcaccgacctcagaatggtcatc
ccgcggcgtgtgccgtcgggctatcggctgcgcgaatgctacgggcccggcgacgcgccg
ctgcgcggcgaatggctcgagcgcaccggcgcggtcgcggcgcgcggcgccggccgcacg
ctgctgtatttccacggcggcggctactacttctgttcgacgaaaacccatcggccgctc
gtgttccggctgacccggcgcgcgggcgtgcgctcgttctcgctcgactaccggctcgct
ccggaaaatcgcttcccggctgcgctcgacgacgcgctggccgcgtatcgccaactgctc
gcgctcggcacgccgcccgagtcgatcgtgttcggcggcgactcggcaggcggcggtctc
gcgctcgcgacactcgtcgcgctgcgcgatcgcggcgagccgttgccggccggcgcgatc
ctgttctcgccgtggaccgatctcgcgggcaccggcgacacgatgcgtaccaacgacggc
cgcgacccgatgttctcggccgccgcgctgccgaaggcggcaaagctgtatctcggtgat
gcaccggcgacgcatccgtatgcgtcgccgctctatgcggatcttgccggactgccgccg
ctgttcatccaggcgggcagcaccgaggtgctgctcgacgatgcgcggcgcgttgccgac
aacgcgaaggcggctggcgtgccggtggaactggaggtgtggcccgacatgccgcacgtg
tggcagctgtacacgccgatggtgccggagtcgcgcgacgcgctcgatcgtgccgcggcg
ttcctgcgtcgcgtcgcggtcgagcgggcgattcagcgcgcgggcgagccgtcgatcgcc
tga

DBGET integrated database retrieval system