KEGG   Burkholderia cenocepacia DWS 37E-2: DM40_3931Help
Entry
DM40_3931         CDS       T03488                                 

Gene name
pcp
Definition
(GenBank) pseudomonalisin
  KO
K05998  pseudomonalisin [EC:3.4.21.100]
Organism
bcew  Burkholderia cenocepacia DWS 37E-2
Brite
KEGG Orthology (KO) [BR:bcew00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bcew01002]
    DM40_3931 (pcp)
Enzymes [BR:bcew01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.100  sedolisin
     DM40_3931 (pcp)
Peptidases and inhibitors [BR:bcew01002]
 Serine peptidases
  Family S53
   DM40_3931 (pcp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pro-kuma_activ Peptidase_S8
Motif
Other DBs
NCBI-ProteinID: AIO39922
Position
2:complement(1102783..1104522)
Genome map
AA seq 579 aa AA seqDB search
MKRNARFALPLPLPRRFACAWPLVFAAGAAHATTDWVDTHTKAFLTGPQLLARSAAPSLE
LAAGETADVVVSLKLRNAAQLKQLAHDVNRPGNAHYRQYLTHEQFLANYAPTEAQVKSVV
DYLRKSGFVNIEVAPNRLLVSARGTAGTVKTAFNTSLVHFEYAGRSGFANASTAQVPRAL
GDVVGSVLGLQNVARARPMLRIGNVSKPQALAAGTATGHYPKEFPGLYNATGVPTAAGVT
VGIVTIGGVSQTLQDLKQFTSSNGYGTVATQTVKTNGTGTTGSYSDDQDGQGEWDLDSQS
IVGSAGGQVGKLVFYMADLNAAGNSGLTRAFNRVVSDNTAKVINVSLGWCETDADADGTL
DAEEQIFTTAAAQGQTFSVSSGDEGVYECNNRGYPDGANYTVSWPAASPHVLAIGGTTLY
TTSSGGFSSETVWNEGLDGNGKLWATGGGVSSILPAPSWQSGSNRRLPDVSFDAAQSTGA
YIYNYGQLQQIGGTSLAAPIFTGFWARLLAANGTGLGFPAAKFYADIPSNPSLVRYDVVS
GNNGYQGYGYTAGAGWDYPTGFGSLNVSNLNKLIQTGGF
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggaatgcccggtttgcccttccccttccgttgccccgccgcttcgcgtgcgcg
tggccgctcgtgttcgcggccggcgccgcgcacgcgacgacggactgggtcgacacccac
acgaaggcctttctgaccggcccgcagctgctggcccgcagcgcggcgccgtcgctcgag
ctcgcggccggcgaaacggccgacgtcgtcgtcagcctgaagctgcgcaatgcggcgcaa
ctgaagcaactcgcgcacgacgtcaaccgccccggcaacgcgcactatcgccagtacctg
acgcacgagcagttcctcgcgaactacgcgccgaccgaagcgcaggtgaagtcagtcgtc
gactatctgcgcaaaagcggcttcgtgaacatcgaggtcgcgccgaaccggctgctggtg
tccgcgcgcggcacggccggcacggtgaaaaccgcattcaacacgtcgctcgtgcatttc
gagtacgcaggccgctccggattcgcgaacgcgtcgaccgcgcaggtgccgcgcgcgctc
ggcgacgtcgtcggctcggtgcttgggctgcagaacgtcgcacgcgcacggccgatgctg
cgcatcggcaacgtctcgaaaccgcaagcgctcgcggccggcacggccaccggccattat
ccgaaggaatttccgggcctttacaacgcaaccggcgtgccgaccgcggccggcgtgacg
gtcggaatcgtcacgatcggcggcgtgtcgcagacgttgcaggacctgaagcagttcacg
tcgagcaatggttacggcacggtcgcgacccagaccgtgaagaccaacggcaccggcacg
accggcagctacagcgacgaccaggacggccagggcgaatgggatctggacagccagtcg
atcgtcggatcggccggcggccaggtcggcaagctggtgttctacatggcggacctgaac
gcagccgggaacagcgggctcacgcgggcgttcaaccgtgtcgtgtcggacaacaccgcg
aaggtgatcaacgtgtcgctcggctggtgcgaaacggacgcggacgcggacggcacgctc
gatgccgaggagcagatcttcacgacggccgccgcgcaaggccagacgttctcggtgtcg
tcaggcgacgaaggcgtgtacgagtgcaacaaccgcggctatccggacggcgcgaactac
acggtgtcgtggccggccgcttcgccgcacgtgctcgcgatcggcggcacgacgctgtac
accacgtcgagcggcgggttctcgagcgagacggtatggaacgaaggcctcgacggcaac
ggcaagctctgggcgacgggtggcggcgtcagctcgatcctgcccgcgccgtcgtggcaa
tcgggcagcaaccgccgtttgccggacgtgtcgttcgacgccgcgcagagcacgggcgca
tatatctacaactacggccagttgcagcaaatcggcggcacgagcctcgccgcgccgatc
ttcaccggcttctgggcccgcctgctcgcggcgaacggcacgggtctcggtttcccggcc
gcgaagttctatgcggacattccatcgaacccgtcgctggtgcgctatgacgtcgtgtcg
ggcaacaacggctatcaggggtatggctacaccgcgggcgccggctgggactacccgacc
ggcttcggcagcctgaacgtgtcgaacctcaacaagctgatccagacgggcggcttctga

DBGET integrated database retrieval system