KEGG   Burkholderia cenocepacia DWS 37E-2: DM40_4340Help
Entry
DM40_4340         CDS       T03488                                 

Definition
(GenBank) phosphoesterase family protein
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
bcew  Burkholderia cenocepacia DWS 37E-2
Pathway
bcew00562  Inositol phosphate metabolism
bcew00564  Glycerophospholipid metabolism
bcew01100  Metabolic pathways
bcew01110  Biosynthesis of secondary metabolites
bcew02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bcew00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    DM40_4340
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    DM40_4340
   00565 Ether lipid metabolism
    DM40_4340
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    DM40_4340
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:bcew02042]
    DM40_4340
Enzymes [BR:bcew01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     DM40_4340
Bacterial toxins [BR:bcew02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   DM40_4340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase
Motif
Other DBs
NCBI-ProteinID: AIO39339
Position
2:complement(1580565..1582238)
Genome map
AA seq 557 aa AA seqDB search
MFRQALLVTACAGAALALFACGGSDDPTSTPPVSSQDALQTATPIKHVVVIYGENVSFDH
YFGTYPNASNPAGEPAFTAKAGTPTVNGLTGTLLTANPNFTNTANGTDAANPFRLDRTQA
ATADQNHAYTAEQQAEDNGLADLFPKYTGKGSSGGAGAFGTKGQVMGYFDGNTVTALWNY
AQRFAMSDNAYTTVYGPSTPGALNVVSGQTNGMQIVKTSKQPSTLAASSYYINDGQGGFT
MINDVDPGYDVCSSTTDQAMMSGKNIGDLLNAAKITWGGFMGGFNLSTTNSNGTTGCARS
TVATAVNAATADYIPHHNWFQYYASTANPQHTRPSSVAAIGSSVETDGKTPEPANHQYDS
DDFFAAVKAGNFPSVSFLKAPAAQDGHAGYSDPLDEQAFVTKVVNFLQQQPDWQNTAVIV
TYDDSDGWYDHAYTAPTHASSDAVDQLNGNGACGSGGTTGVNGGTVNGRCGPGVRIPLVV
ISPYAKQNYVDHTMIDQASVVRFIEDNWLGGQRIGGGSFDATAGDLRGLFDFASKPNTAP
LYLDPTQGTVLSAAPSI
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgttccgtcaagccttgctcgtcactgcctgcgccggcgcagcgctggcgctgttcgcc
tgcggcggcagcgacgatcccacgtcgacgcctcccgtgtcgtcgcaggatgcgctgcag
actgccacgccgatcaagcacgtcgtcgtcatctacggcgaaaacgtgtcgttcgaccac
tacttcggcacctatccgaacgcgtcgaatccggccggcgaaccggcgttcactgcgaag
gccggcacgccgacggtcaacggactgacgggcacgctgctcaccgcgaacccgaacttc
acgaacacggccaacggcaccgatgccgcgaacccgttccgcctcgatcgcacgcaggcc
gcgaccgccgaccagaaccacgcgtacacggccgagcagcaggccgaggacaacggcctc
gccgacctgttcccgaaatacaccggcaagggctcgtccggcggcgccggcgcgttcggc
acgaagggccaggtgatgggctacttcgacggcaacaccgtcaccgcgctgtggaactac
gcgcagcgcttcgcaatgagcgacaacgcatacacgacggtgtacggcccgtcgacgccg
ggcgcactgaacgtcgtgtcgggccagaccaacgggatgcagatcgtcaagacgtcgaag
cagccgtcgacgctcgccgccagctcgtactacatcaacgacggccagggcggcttcacg
atgatcaacgacgtcgatccgggctacgacgtgtgctccagcacgaccgaccaggcgatg
atgagcggcaagaacatcggcgacctgctgaatgccgcgaagatcacgtggggcggcttc
atgggcggcttcaacctgtcgacgaccaacagcaacggcacgaccggctgcgcgcgcagc
accgtcgccaccgccgtgaacgccgcgaccgccgactacattccgcaccacaactggttc
cagtactacgcgtcgaccgcgaacccgcagcacacgcgcccgagctcggtcgcggcgatc
ggttcgagcgtcgaaaccgacggcaagacgcccgaaccggcgaaccaccagtacgacagc
gacgacttcttcgctgcagtgaaggccggaaacttcccgtcggtcagcttcctgaaggcg
ccggccgcgcaggacgggcacgcgggctactcggatccgctcgacgagcaggcgttcgtc
acgaaggtcgtgaacttcctgcagcagcagcccgactggcagaacacggccgtgatcgtc
acgtatgacgactcggacggctggtacgaccacgcgtacacggcgccgacccatgcgtcg
tccgatgccgtcgatcagctcaacggcaacggcgcgtgcggctcgggcggcaccaccggc
gtgaacggcggcacggtgaacggccgctgcggcccgggtgtgcgcattccgctcgtggtg
atctcgccgtacgcgaagcagaactacgtcgaccatacgatgatcgaccaggcgtccgtc
gtgcgcttcatcgaggacaactggctcggcggccagcgcatcggcggcggttcgttcgat
gcgaccgcgggcgacctgcgcggcctgttcgacttcgcgtcgaagccgaacacggcgccg
ctgtatctcgatccgacgcagggcaccgtgctgagcgcggcaccgtcgatctga

DBGET integrated database retrieval system