KEGG   Burkholderia cenocepacia DWS 37E-2: DM40_5000Help
Entry
DM40_5000         CDS       T03488                                 

Gene name
dmpG
Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
bcew  Burkholderia cenocepacia DWS 37E-2
Pathway
bcew00360  Phenylalanine metabolism
bcew00362  Benzoate degradation
bcew00621  Dioxin degradation
bcew00622  Xylene degradation
bcew01100  Metabolic pathways
bcew01120  Microbial metabolism in diverse environments
bcew01220  Degradation of aromatic compounds
Module
bcew_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bcew00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    DM40_5000 (dmpG)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DM40_5000 (dmpG)
   00622 Xylene degradation
    DM40_5000 (dmpG)
   00621 Dioxin degradation
    DM40_5000 (dmpG)
Enzymes [BR:bcew01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     DM40_5000 (dmpG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm
Motif
Other DBs
NCBI-ProteinID: AIO39990
Position
2:complement(2346474..2347493)
Genome map
AA seq 339 aa AA seqDB search
MDKRLYISDVTLRDGMHAIRHQYSIENVQDIARALDDAKVDSIEVAHGDGLQGSSFNYGF
GAHSDLEWIEAVADVVKHAKIATLLLPGIGTIHDLKAAYDAGARVVRVATHCTEADISKQ
HVEYARSLGMDTVGFLMMSHMTTPDQLAIEAKKMESYGATCVYVVDSGGAMNMNDIRARF
RALKAVLRPETHTGMHAHHNLSLGVANSIVAVEEGCDRVDASLAGMGAGAGNAPLEVFIA
AAERLGWHHGTDLYRLLDAADDIVRPLQDRPVRVDRETLALGYAGVYSSFLRHSEIAAKK
YGLKAVDILVELGKRRMVGGQEDMIVDVALDLKKRAAHA
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggacaagagactctacatctccgatgtgacgctgcgcgacggcatgcacgcgatccgt
catcagtattcgattgaaaacgtgcaggacattgcacgcgcgctggacgacgcgaaggtc
gacagcatcgaggtcgcgcacggcgacggcttgcagggctcgagcttcaactatggcttc
ggcgcgcacagcgatctggaatggatcgaggcggtagccgatgtggtgaagcacgcgaaa
atcgcgacgctgctgctgcccggcatcggcacgattcacgacctgaaggctgcgtacgac
gcaggcgcgcgagtcgtacgtgtcgcgacccattgcacggaagcggacatttcgaagcag
cacgtcgaatatgcgcgcagcctcggcatggatacggtcggcttcctgatgatgagtcac
atgaccacgcccgaccagctcgcgatcgaggcgaagaagatggaaagctacggtgcgacc
tgcgtgtacgtggtcgattccggcggcgcgatgaacatgaacgacattcgggcgcgcttc
agggcgctcaaggccgtgcttcgccccgagacccacacgggcatgcatgcccatcacaac
ctgagcctcggcgtggccaactcgatcgtcgcggtcgaagaaggctgcgaccgtgtcgat
gcgagcctggcgggcatgggcgcgggagcgggcaacgcaccgctcgaagtgttcatcgcg
gcggccgagcgccttggctggcatcacggcacggatctctatcggttgctcgacgcggcc
gacgatatcgtccgcccgttgcaggaccgaccggtgcgcgtggaccgcgaaacgctcgcg
ctcggctatgcgggcgtgtattcgagcttcctgcggcattccgaaatcgcggcgaagaag
tacgggctgaaggccgtcgacattctcgtcgaactgggcaagcggcgcatggtgggcggt
caggaagacatgatcgtcgatgtcgcactggatctgaagaagcgcgcagcccacgcgtga

DBGET integrated database retrieval system