KEGG   Bacillus cereus F837/76: bcf_00260Help
Entry
bcf_00260         CDS       T01703                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bcf  Bacillus cereus F837/76
Pathway
bcf00900  Terpenoid backbone biosynthesis
bcf01100  Metabolic pathways
bcf01110  Biosynthesis of secondary metabolites
bcf01130  Biosynthesis of antibiotics
Module
bcf_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bcf00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    bcf_00260
Enzymes [BR:bcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     bcf_00260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: AEW53271
Position
48109..48978
Genome map
AA seq 289 aa AA seqDB search
MKLLVKAPAKINLSLDVLGKRQDGYHEVKMIMTTIDLADRLELMELAEDRIEILSHNRYV
PDDQRNLAYQAAKLLKEKFNVKKGVSITIEKTIPVAAGLAGGSSDAAATLRGLNKLWNLG
LTIDQLAELGAEIGSDVSFCVYGGTAIATGRGEQIEHIKTPPSCWVILAKPHIGVSTADV
YGNLKLNRVTHPNVDKMVDVINAGDYKGICDTVGNVLEDVTFAMHPEVARIKAQMKRFGA
DAVLMSGSGPTVFGLVHHDSRMHRIYNGLKGFCEQVYAVRLLGERETLE
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
ttgaagctactagtgaaagcaccagcaaagattaatctgtcgttagatgtactgggaaaa
agacaagacggatatcatgaagtgaaaatgattatgacaacaatcgatttagcggatcgt
ttagaactaatggaattagcagaagaccgtattgaaattttatcccataatcggtatgtc
ccagacgaccaaagaaatctggcttatcaagcagcgaaattattaaaagagaagtttaat
gtgaaaaaaggtgtatctattactattgaaaaaacgattccagtagcagctggattagcg
ggtggaagtagtgatgcagcagcgacattacgtggtcttaataaattatggaatttaggc
cttacgattgatcaattagcagagcttggcgcagaaattggatcagatgtatcgttttgt
gtatatggtgggacagcaattgccactggaagaggagagcagattgagcacataaaaact
ccaccttcttgttgggttattttagcaaagcctcatattggtgtatctactgctgatgta
tatggaaatttaaagttaaatcgagttacacatccaaatgtagataaaatggtggatgtc
ataaacgctggagactacaaagggatttgcgatactgttggtaacgttttagaagatgta
acgtttgctatgcatcctgaagttgcacgtattaaagcacaaatgaagcgatttggagca
gatgctgtattaatgagtggaagtggtccaactgtattcggcctagtgcaccatgattcg
cgaatgcatcgtatatataacggattaaaaggattttgtgaacaagtatacgcagtacgt
ttattaggagagcgagaaacgcttgaataa

DBGET integrated database retrieval system