KEGG   Bacillus cereus F837/76: bcf_03455Help
Entry
bcf_03455         CDS       T01703                                 

Definition
(GenBank) 2,3-butanediol dehydrogenase, R-alcohol forming, (R)- and (S)-acetoin-specific
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bcf  Bacillus cereus F837/76
Pathway
bcf00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bcf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    bcf_03455
Enzymes [BR:bcf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     bcf_03455
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     bcf_03455
    1.1.1.-  
     bcf_03455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc 2-Hacid_dh_C TrkA_N Gp_dh_N
Motif
Other DBs
NCBI-ProteinID: AEW53837
Position
674379..675431
Genome map
AA seq 350 aa AA seqDB search
MKALLWHNQRDVRVEEVPEPTVKPGAVKIKVKWCGICGTDLHEYLAGPIFIPTEEHPLTH
VKAPVILGHEFSGEVVEIGEGVTSHKVGDRVVVEPIYSCGKCEACKHGHYNVCEQLVFHG
LGGEGGGFSEYTVVPEDMVHHIPDEMTYEQGALVEPAAVAVHAVRQSKLKEGEAVAVFGC
GPIGLLVIQAAKAAGATPVIAVELSKERQELAKLAGADYVLNPATQDVLAEIRNLTNGLG
VNVSFEVTGVEVVLRQAIESTSFEGQTVIVSVWEKDATITPNNLVLKEKEVVGILGYRHI
FPAVIKLISSGQIQAEKLITKKITVDQVVEEGFEALVKDKTQVKILVSPK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattactttggcataatcaacgtgatgtaagagtagaagaagtaccagaacca
actgtaaaaccaggagcagttaagattaaagttaaatggtgtggtatctgcgggacagac
ttgcatgaatatttagcaggacctatttttattccgacagaagagcatccattaacacat
gtaaaagcaccggttattttaggtcatgagtttagcggtgaggtagttgaaatcggtgaa
ggcgttacatctcataaagtgggagaccgcgtcgttgtagaaccaatttattcttgtggt
aaatgtgaagcttgtaaacatggacattacaatgtttgtgaacaacttgttttccacggt
cttggcggagaaggcggcggtttctctgaatatacagtagtaccagaagatatggttcac
catattccagatgaaatgacgtatgaacaaggtgctcttgtagaaccagcagcagtagcg
gttcatgcagtacgtcaaagtaaattaaaagaaggggaagcagtagcagtctttggttgt
ggtccaattggacttcttgttatccaagcagctaaagcagcaggagcaactcctgttatt
gcagttgaactttctaaagaacgtcaagagttagcaaaattagcaggtgcggattacgta
ttgaatccagcgactcaagatgtattagctgaaattcgcaacttaacaaatggtttaggt
gtaaatgtaagctttgaagtaactggtgttgaagtagtacttcgtcaagcaattgaaagc
acaagctttgaaggacaaactgtaattgttagtgtatgggaaaaagacgcaacaattact
ccaaataatcttgtactaaaagaaaaagaagtggttggtattttaggataccgtcatatc
ttcccagctgttattaaattaattagctctggccaaattcaggcagagaaattaattacg
aaaaaaatcacagtagatcaagttgttgaagaaggatttgaagcacttgtaaaagataaa
acacaagtgaaaattcttgtttcacctaaataa

DBGET integrated database retrieval system