KEGG   Bacillus cereus F837/76: bcf_05670Help
Entry
bcf_05670         CDS       T01703                                 

Definition
(GenBank) Malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
bcf  Bacillus cereus F837/76
Pathway
bcf00620  Pyruvate metabolism
bcf00630  Glyoxylate and dicarboxylate metabolism
bcf01100  Metabolic pathways
bcf01110  Biosynthesis of secondary metabolites
bcf01120  Microbial metabolism in diverse environments
bcf01200  Carbon metabolism
Module
bcf_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bcf00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    bcf_05670
   00630 Glyoxylate and dicarboxylate metabolism
    bcf_05670
Enzymes [BR:bcf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     bcf_05670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AEW54257
Position
1081587..1083176
Genome map
AA seq 529 aa AA seqDB search
MSTQTSRVTLVGEMLPAYNEILTPEALSFLKELHENFNERRIELLQKRVKKQQKIDAGEF
PKFLEETKRIREADWTIAKLPKDLEDRRVEITGPVDRKMVINALNSGAHLFMADFEDSNS
PTWENAIEGQINLRDAVKGTISHKNENGKEYRLNSKTAVLIVRPRGWHLEEKHMQVDGKN
MSGSLVDFGLYFFHNAKALLEKGSGPYFYLPKMESYLEARLWNDVFVFAQKYIGIPNGTI
KATVLLETIHASFEMDEILYELKDHSAGLNCGRWDYIFSFLKAFRNHNEFLLPDRAQVTM
TAPFMRAYSLKVIQTCHRRNAPAIGGMAAQIPIKNNPEANEAAFEKVRADKEREALDGHD
GTWVAHPGLVPVAMEVFNHIMKTPNQIFRKREEIHVTEKDLLEVPVGTITEEGLRMNISV
GIQYIASWLSGRGAAPIYNLMEDAATAEISRAQVWQWIRHEGGKLNDGRNITLELMEELK
EEELAKIEREIGKEAFKKGRFQEATTLFTNLVRNDEFVPFLTLPGYEIL
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgcaaacttcacgggttacactcgtgggagaaatgttaccagcgtacaacgaa
atattgacacctgaggcgcttagttttttaaaggaactacatgaaaattttaatgagcgc
cgcatagaacttttacaaaagcgtgtgaaaaaacaacagaaaattgatgcaggagagttt
ccgaagtttttagaagaaacaaagcgtatacgtgaagcggattggacaattgctaaattg
ccaaaagatttagaggatcgccgcgtagagattactggtccagtagatagaaagatggtt
attaacgctttaaattcgggagcacatctttttatggcggattttgaagattcgaattca
ccaacttgggaaaatgcgattgaaggtcaaataaacttacgagatgcagtaaagggaacg
atttcacataaaaatgaaaacggaaaagaatatcgtttaaatagtaaaacagctgtatta
attgtgcgtccaaggggatggcatttagaagaaaaacatatgcaagttgacggaaaaaat
atgtctggtagcttagtagatttcggactttattttttccataatgcgaaagctctttta
gaaaaaggaagcggtccatacttttacttaccgaaaatggaaagctatttagaagcaaga
ttatggaatgatgttttcgtatttgctcaaaaatatatcggtattccaaatggaacgatc
aaagcaacggtgttactggaaacgattcacgcttcgtttgaaatggatgaaattttgtat
gagcttaaagatcattctgctggattaaattgcggaagatgggattatatttttagtttt
ctaaaagctttccgtaatcataatgaatttttacttcctgacagagcgcaagtcacgatg
acggcgccgtttatgcgcgcgtattctttgaaagtcattcaaacctgtcaccgccgtaat
gcaccagctattggagggatggcagcacaaattccgattaaaaacaatcctgaagcgaat
gaagctgcttttgaaaaagtgcgtgctgataaggagcgcgaagctttagacggtcatgac
gggacttgggttgcccacccgggacttgtgccagtcgcgatggaagtatttaatcacatt
atgaaaacaccgaatcaaatttttagaaaacgagaagaaatacatgttacagaaaaggat
ttattagaagtaccagtgggaacgattacagaagagggtcttcgtatgaatattagcgta
ggcattcaatatatcgcatcttggttaagcggacggggagcagcaccaatttataactta
atggaagatgcggcaacagctgaaatctcaagagcacaagtatggcaatggattcgccat
gaaggtggaaaattaaatgatggccgtaatattacacttgaattaatggaagagttaaaa
gaagaagagttagcaaaaatagaaagagagattggtaaagaagcctttaagaaagggaga
ttccaagaggcgacaacgttgtttacaaatctcgttcggaatgatgaattcgtaccattt
ttaacattaccaggttatgaaattttataa

DBGET integrated database retrieval system