KEGG   Bacillus cereus F837/76: bcf_06220Help
Entry
bcf_06220         CDS       T01703                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bcf  Bacillus cereus F837/76
Pathway
bcf00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bcf01100  Metabolic pathways
bcf01110  Biosynthesis of secondary metabolites
bcf01130  Biosynthesis of antibiotics
bcf01230  Biosynthesis of amino acids
Module
bcf_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bcf00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    bcf_06220
Enzymes [BR:bcf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     bcf_06220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE FMN_dh His_biosynth
Motif
Other DBs
NCBI-ProteinID: AEW54367
Position
1183224..1183985
Genome map
AA seq 253 aa AA seqDB search
MGTILDKIVDQKKKEVAALYETYTPVKEKRKTRSLVKALEQFTVIAEVKRASPSKGDINL
HVDVRKQVKTYEECGAGAVSVLTDGQFFKGSFYDLQTAREESSIPLLCKDFIIDKIQIDR
AYEAGADIILLIVAALTKEKLKELYSYVLEKGLEAIVEVHDEKELEIAIQLNPHVIGINN
RNLKTFEVDLSQTEKLGKRLNEEKLLWISESGIHSKEDIICVKRAGAKGVLVGEALMTSS
SIHTFFEDCKVNI
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtggggacgattttagacaaaattgtagatcaaaagaaaaaggaagttgcggcattatat
gaaacatatacaccagtaaaagaaaaaagaaaaacgcgctcacttgtaaaggctctagag
caatttactgtcatcgcagaagtaaagcgagcatcaccatcaaaaggagatattaattta
cacgttgatgtacgaaaacaagtgaagacatatgaagaatgcggcgctggtgcagtttct
gttttaacagacggtcaattttttaaagggtcattttatgatttacaaacggcaagagaa
gaaagtagcattccgcttttatgtaaagatttcataatcgataagattcaaattgataga
gcgtatgaagctggtgcagatattattttactaatcgtagcggcgttaacgaaagaaaaa
ttaaaagagttgtatagctacgtactagaaaaaggattagaagcgattgttgaagttcat
gatgaaaaggaattagaaattgcaattcaattaaatccgcacgttatcggtattaacaac
cgtaatttaaaaacattcgaagtcgatttaagtcaaacagaaaagcttggaaaacgatta
aatgaggagaaattactttggattagtgagagcgggattcattcaaaagaagacataatc
tgcgttaaacgagctggggcaaaaggtgtattagttggagaagcgcttatgacatcgtct
tctattcataccttttttgaagattgtaaggtgaacatatga

DBGET integrated database retrieval system