KEGG   Bacillus cereus F837/76: bcf_09690Help
Entry
bcf_09690         CDS       T01703                                 

Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bcf  Bacillus cereus F837/76
Pathway
bcf00260  Glycine, serine and threonine metabolism
bcf00750  Vitamin B6 metabolism
bcf01100  Metabolic pathways
bcf01110  Biosynthesis of secondary metabolites
bcf01120  Microbial metabolism in diverse environments
bcf01230  Biosynthesis of amino acids
Module
bcf_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bcf00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    bcf_09690
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    bcf_09690
Enzymes [BR:bcf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     bcf_09690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP PK_C
Motif
Other DBs
NCBI-ProteinID: AEW55060
Position
1829329..1830387
Genome map
AA seq 352 aa AA seqDB search
MYKGLLKQYASYLPVNENTPDVSLMEGNTPLIPLLNISNQLGIQLYGKYEGANPTGSFKD
RGMVMAVAKAKEEGSEAIICASTGNTSASAAAYAARLGMKCIIVIPEGKIAHGKLAQAVA
YGAEIISIEGNFDDALKAVRNIAAEEPITLVNSVNPYRIEGQKTAAFEICDQLQSAPDVL
AIPVGNAGNITAYWKGFCEYEKEKGYKKPRIHGFEAEGAAAIVKGQVIEEPETIATAIRI
GNPASWSYAVEAAQQSHGEIDMVSDEEILHAYRLLAKSEGVFAEPGSNASLAGVMKHVQS
GKIKKGETVVAVLTGNGLKDPDIAISSNTLDIASVSNNIEQIKEHIKGVIMS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaggattattaaaacagtatgcttcttatttaccggtgaatgaaaacacacca
gatgtgagcttaatggaaggaaatacacctcttattccgttgttaaatatatcaaaccaa
ttagggattcagttatacgggaagtatgaaggagcgaatccgacaggttcttttaaagat
cgaggcatggtaatggctgttgcgaaggcgaaagaagaaggttcggaggcaatcatttgt
gcgtcaacaggtaatacatcagcatcggccgcagcatacgcggcacgtcttggaatgaaa
tgtattatcgtaatcccagaagggaaaattgcacatggaaaattagcgcaagcagttgcg
tatggtgctgaaatcatttcaatagaaggaaattttgatgatgcattaaaagctgtaaga
aatattgctgcggaagagccgattacgttagtaaactcagtgaatccttatcgaattgaa
gggcaaaaaacagcagcgtttgaaatttgtgatcagctgcaaagtgcaccagatgttcta
gcgattcctgttgggaatgcgggaaatattacagcgtattggaaaggtttctgtgaatat
gagaaagaaaaaggctataagaaaccaagaattcacggatttgaagcggaaggagcagct
gctattgtaaaagggcaggttattgaagaacctgaaacaattgcaactgcgattcgcatc
ggtaacccagcaagttggtcatatgcggtagaggctgctcagcaatctcacggcgaaata
gatatggtatcagatgaggagattttacatgcgtatagattattagcaaaatcggaaggg
gttttcgctgagccaggatcaaatgcttcattagctggcgtaatgaaacatgttcaatct
ggaaaaatcaaaaagggagaaacagttgttgcagttttaactggaaatggcttgaaagat
cctgatatcgcaatttcttctaatacattagatattgcaagtgtctcaaataatatagaa
caaattaaagagcatattaaaggggtgattatgtcgtga

DBGET integrated database retrieval system