KEGG   Bacillus cereus F837/76: bcf_10170Help
Entry
bcf_10170         CDS       T01703                                 

Definition
(GenBank) 4-hydroxyphenylacetate 3-monooxygenase
  KO
K16901  anthranilate 3-monooxygenase (FAD) / 4-hydroxyphenylacetate 3-monooxygenase [EC:1.14.14.8 1.14.14.9]
Organism
bcf  Bacillus cereus F837/76
Pathway
bcf00350  Tyrosine metabolism
bcf00380  Tryptophan metabolism
bcf01100  Metabolic pathways
bcf01120  Microbial metabolism in diverse environments
bcf01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bcf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    bcf_10170
   00380 Tryptophan metabolism
    bcf_10170
Enzymes [BR:bcf01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.8  anthranilate 3-monooxygenase (FAD)
     bcf_10170
    1.14.14.9  4-hydroxyphenylacetate 3-monooxygenase
     bcf_10170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HpaB_N HpaB Acyl-CoA_dh_M TolA_bind_tri
Motif
Other DBs
NCBI-ProteinID: AEW55156
Position
1919176..1920648
Genome map
AA seq 490 aa AA seqDB search
MAIRTGEQYIEGLRKRNPEIWIGGRKVTDVVNEDVFREPIIQIANLYDMQHNPEYQDKIT
HICEETGERVSNAFLVPRNYEDLKVRRELFEVWAKATYGLMGRTPDFLNVTVTSMASNSW
FFEKFNPEWGANIKNYYKHIRDNDLFLTHAIINPQNDRSKASHQQEDETMHLGVVSETAE
GMYVSGAKMLATLAPITDEVIIYSYPSFKPGDERHAISFAVPIDAPGLRILCREPMQDGK
RSLFDHPLASRFEEMDALLVFHNVFIPWDKVFIYQSVEAGNQLYPKTGIGHQPAHQSGVR
GLVKLSFAAEVAMKLADSIGVDGFLNVQNQLAELMQDVETIRALLQVAEYEYETNSYGEV
IPARLPLDTIRSLLPKMYPRAIEIIQTIGAGGLLMSPTGADFMNPEIHDDMQKYYIGREG
VSSEERVRLFKLAWDLCGEAFGQRLLQYERYYSGDPVRKMGMFYNAYKKQQTFSLVNNAL
QSSSSEGALS
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggcaattagaacaggggaacagtatattgaagggttgcgaaaaagaaatcctgaaatt
tggattggaggaagaaaagtaacggatgtagtaaatgaagatgtttttcgtgaaccaatt
atacaaattgcgaacttatatgatatgcagcacaatccagaatatcaagataagattact
catatatgcgaagagacaggagaaagggtatcaaatgcatttttagtaccgagaaattat
gaggatttaaaagtacgccgcgaattatttgaagtgtgggcaaaagccacttatggttta
atgggtagaacacctgattttttaaatgtaacggttacttcaatggcaagtaattcgtgg
ttttttgagaagtttaatccagaatggggagcgaatataaaaaattattataaacatata
agggataatgatttgtttttaacacacgcaattattaatccgcaaaatgatcggagtaag
gcctcccatcaacaagaagatgaaacaatgcatttaggggtagtaagtgaaacagcggaa
ggaatgtatgttagtggtgctaaaatgttagcgacactggcgccgattacggatgaggta
ataatatattcctatccaagttttaagccaggtgatgaacgtcatgcaatttcttttgca
gttccaattgacgcaccaggtctaagaattctatgtcgtgagccaatgcaagatggaaaa
cgatctttatttgatcacccacttgcatcaaggtttgaggaaatggatgcattactagta
tttcataatgtgtttatcccgtgggataaagtatttatttatcaaagtgtggaagctggg
aatcaattgtatcctaaaaccggaattggtcatcaaccagcacatcaatctggggtaaga
gggttagtaaaactatcttttgcagctgaagtagctatgaaattagcagattcgattgga
gtagatggttttttaaatgtacaaaaccagttagcagagcttatgcaagatgtcgaaacg
atacgtgctctcctgcaagtagctgaatatgagtatgaaacgaattcatatggagaagtt
attcctgcgaggttaccgcttgatacgatacgcagtttattacctaagatgtatccgcgg
gctattgagattattcaaactataggtgcgggtggattattaatgtcaccgacaggtgct
gattttatgaaccccgagattcatgatgatatgcaaaagtattatatcgggcgtgaagga
gtatcctctgaggaacgggttcgtttgtttaaattagcatgggacttatgtggtgaggct
tttggacaacggttattacaatatgagcgttattattctggagatccggtgcgtaaaatg
ggaatgttttataatgcgtacaaaaaacaacaaactttttcacttgtgaacaatgcgttg
caatcgagttcatctgaaggggccttaagttaa

DBGET integrated database retrieval system