KEGG   Bacillus cereus F837/76: bcf_17995Help
Entry
bcf_17995         CDS       T01703                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bcf  Bacillus cereus F837/76
Pathway
bcf00071  Fatty acid degradation
bcf00072  Synthesis and degradation of ketone bodies
bcf00280  Valine, leucine and isoleucine degradation
bcf00310  Lysine degradation
bcf00362  Benzoate degradation
bcf00380  Tryptophan metabolism
bcf00620  Pyruvate metabolism
bcf00630  Glyoxylate and dicarboxylate metabolism
bcf00640  Propanoate metabolism
bcf00650  Butanoate metabolism
bcf00900  Terpenoid backbone biosynthesis
bcf01100  Metabolic pathways
bcf01110  Biosynthesis of secondary metabolites
bcf01120  Microbial metabolism in diverse environments
bcf01130  Biosynthesis of antibiotics
bcf01200  Carbon metabolism
bcf01212  Fatty acid metabolism
bcf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bcf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    bcf_17995
   00630 Glyoxylate and dicarboxylate metabolism
    bcf_17995
   00640 Propanoate metabolism
    bcf_17995
   00650 Butanoate metabolism
    bcf_17995
  09103 Lipid metabolism
   00071 Fatty acid degradation
    bcf_17995
   00072 Synthesis and degradation of ketone bodies
    bcf_17995
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    bcf_17995
   00310 Lysine degradation
    bcf_17995
   00380 Tryptophan metabolism
    bcf_17995
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    bcf_17995
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    bcf_17995
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    bcf_17995
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bcf04147]
    bcf_17995
Enzymes [BR:bcf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     bcf_17995
Exosome [BR:bcf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   bcf_17995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEW56720
Position
complement(3400202..3401293)
Genome map
AA seq 363 aa AA seqDB search
MNRAVIVEAKRTPIGKKNGMLKDYEVQQLAAPLLTFLSKGMERAIDDVILGNVVGPGGNV
ARLSALEAGLSHHIPGVTIDRQCGAGLEAIRTACHFIQGGAGKCYIAGGVESTSASPFQN
RARFSPETIGDPNMGVAAEYVAERYNITREMQDEYACLSYKRTLQALEKGYIHDEILSFH
GLLDESIKPEMNYERIIKRTKPAFLHNGTVTAGNSCGVNDGACAVLVMEEGQARKLGYKP
VLRFVRSAVVGVDPNLPGTGPIFAVNKLLNERNMKVEDIDYFEINEAFASKVVACAKELQ
IPFGKLNVNGGAIALGHPYGASGAMLVTRLFYQAKRERMKYGIATLGIGGGIGLALLFEK
VED
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaatagagcagttattgtagaagcgaaaaggacacctattggtaagaagaatgggatg
ttaaaagactatgaagttcagcaattagcagcgccgcttcttacatttttaagtaaagga
atggagagagcaatagacgatgtcatattagggaatgttgttgggccaggggggaatgtt
gcgagattatctgctttagaagcagggcttagtcatcatattccgggtgtaacgattgac
cggcaatgtggtgccggattggaagcgattcgcaccgcatgtcatttcattcaagggggg
gccggtaagtgctatatcgccggaggggtagagagtacaagtgcgtcaccttttcaaaat
agggcgcgattttcaccagaaacaattggcgatcctaatatgggagtagcggctgaatat
gttgcagaacgttataacatcacgagagaaatgcaagatgagtatgcatgcctcagttat
aaacgaacactgcaagcattagaaaaaggatatatacatgatgaaatattgtcttttcat
ggattattagatgaatctataaagccagaaatgaattatgaacgaattattaaaagaaca
aaacctgcatttttacacaatggtacagtaacggcaggtaattcgtgcggtgtcaatgat
ggggcatgtgctgttcttgtaatggaagaggggcaagctcgaaaattaggatacaagcct
gtccttcgtttcgttcgtagtgctgtagttggagtagatccaaatcttccggggactggt
ccgatatttgcggtgaacaaattattaaacgaaaggaatatgaaagtagaggacatcgat
tattttgaaataaatgaagcattcgcctcaaaagttgtagcttgtgcaaaggagttacaa
attcctttcggaaaattaaatgtaaatggtggggcaattgcgcttggtcatccgtacggt
gcatctggggctatgcttgtaacgcgcttgttttatcaggcgaaacgagagcgtatgaaa
tatggaatcgcaacgttaggaatagggggcgggataggtcttgcactattatttgagaaa
gtagaagactag

DBGET integrated database retrieval system