KEGG   Bacillus cereus F837/76: bcf_26405Help
Entry
bcf_26405         CDS       T01703                                 

Definition
(GenBank) Mannose-1-phosphate guanylyltransferase (GDP)
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
bcf  Bacillus cereus F837/76
Pathway
bcf00051  Fructose and mannose metabolism
bcf00520  Amino sugar and nucleotide sugar metabolism
bcf01100  Metabolic pathways
bcf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bcf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    bcf_26405
   00520 Amino sugar and nucleotide sugar metabolism
    bcf_26405
Enzymes [BR:bcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     bcf_26405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase MannoseP_isomer Cupin_2 NTP_transf_3 AraC_binding Ectoine_synth Cupin_1
Motif
Other DBs
NCBI-ProteinID: AEW58374
Position
complement(4990035..4991408)
Genome map
AA seq 457 aa AA seqDB search
MKLVLLSGGSGKRLWPLSNDSRSKQFLKVLKSEKNEMQSMVQRVWGQLTSLGIENDVVIA
TSKSQVDMINSQLGNDVSIIIEPERRDTFPAIALAASYLYSKEHVDLDEVVGVLPVDPYV
ENSFFERLLDLESALNSSNADLGLMGVTPTYPSEKYGYIVPNVEKSTQELIQVSHFKEKP
ATAEAEELLKQNALWNSGVFAFKLDKIISLLDQKGLPVQYDMLVQQYASLPKISFDYEVV
EKTENIVALPYSGSWKDLGTWNTLTEEMGTDILGKGNMGIECEQNHIINELDIPVSVLGL
SNIIVAASPDGILVSEKDASPRVKELVGDWDQRPMYEERRWGWYRVLDHTKYDDGNEVLT
KRIGITASKNLSYQYHNNRSEVWTVVKGEGIFVLDEEIRVVRPGDVLEIQPRQKHAIKAV
TDLEFIEVQSGSELIEEDIVRIYMQWNEIEEACYLKK
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgaagttagtgttactatcaggtggatctggaaagcgtctttggccattatcgaacgat
tcacgctctaaacaatttttaaaagtacttaaaagtgaaaagaatgaaatgcaatctatg
gttcaaagagtatggggacaattaacaagtttagggattgaaaatgatgtggttattgct
acaagtaaatctcaagtagatatgatcaatagccagctaggaaatgatgtatctattatc
atcgagccagaacgccgtgatacattccccgcaatcgctcttgctgcttcatatctatat
tctaaagagcacgttgatttggatgaggttgtaggtgtattacctgtggatccatacgta
gaaaatagtttctttgaaaggctattggatttagaaagtgcactaaactcttcaaacgca
gatctaggtttaatgggggttactcctacatatccatctgaaaaatatggttatattgtt
ccgaatgtagagaagagtacacaggaacttattcaagtaagtcattttaaagaaaaacca
gccactgccgaggcggaagagttactaaaacaaaacgcactttggaacagtggcgtattt
gcatttaaattagataaaattatctccttattagatcaaaagggacttcctgttcaatat
gatatgttagttcaacaatatgcaagtttaccaaagataagttttgactatgaagtagta
gagaaaacagaaaatattgttgcacttccttatagcggttcatggaaagatcttggaact
tggaatacccttaccgaagaaatggggacggacatccttggtaaaggaaatatggggatt
gaatgtgagcaaaaccatattattaatgagctagatatcccagtttctgtattaggtctt
tctaatataattgtagctgctagcccagatggtattttagtatcagaaaaagatgcaagc
cctagagtgaaagaattagtgggggattgggatcaaagaccaatgtatgaagagcgacgc
tggggttggtaccgtgtactagatcatactaaatatgatgatggaaacgaagtattaacg
aagcgtattggtattacagctagtaaaaatttaagctatcaatatcataataatagaagt
gaagtttggacagttgtaaaaggtgaaggtatttttgtattagatgaagaaatacgagtt
gttcgccctggggatgtgttggaaattcagccaagacagaagcatgcaattaaagctgtt
acagatttggagtttattgaggtgcaatcaggaagcgaattaattgaggaagatattgtt
cgaatttatatgcaatggaacgagatagaggaagcttgttatttaaaaaagtaa

DBGET integrated database retrieval system