KEGG   Bacillus cereus G9842: BCG9842_B0067Help
Entry
BCG9842_B0067     CDS       T00815                                 

Definition
(GenBank) putative methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bcg  Bacillus cereus G9842
Pathway
bcg00450  Selenocompound metabolism
bcg00970  Aminoacyl-tRNA biosynthesis
bcg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BCG9842_B0067
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BCG9842_B0067
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bcg01007]
    BCG9842_B0067
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bcg03016]
    BCG9842_B0067
Enzymes [BR:bcg01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BCG9842_B0067
Amino acid related enzymes [BR:bcg01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BCG9842_B0067
Transfer RNA biogenesis [BR:bcg03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BCG9842_B0067
 Prokaryotic type
   Other AARSs
    BCG9842_B0067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f Laminin_EGF DUF5457
Motif
Other DBs
NCBI-ProteinID: ACK96837
UniProt: B7INU9
Position
complement(4929803..4931437)
Genome map
AA seq 544 aa AA seqDB search
MSIFIGGAWPYANGSLHLGHIASLLPGDILARYYRAKGENVLYVSGSDCNGTPIAIRAKQ
EGVTAKEIANKYHEEFQRCFRDLGFTYDCYTRTDSEHHHETVQKVFLRLLEEGYIYKKTV
EQAYCKTCTQFLPDRYVEGICPHCHEAARGDQCDACSAILDPLDLLEKTCKLCGSTPSVE
ETEHFYFALHTFQQQIKKVVEIAKEKGTWRDNAIQLTERYVKEGLQDRVVSRDLPIGVPI
PVKGYEDKKIYVWIEAVAGYYSASKYWAEETGKDDHEFWNSDAQTYYVHGKDNIPFHSII
WPAVLLGIGEEAIPRHIVSNEYLTVEKRKLSTSKNWAVWVPDILERYNPDSIRYFLTVNA
PENRDTDFSWREFIYSHNSELLGAYGNFVNRTLKFIEKYYDGIVPQGTINVELKDKVEGL
YKNVGEAIEQTTFKVALETIFDAVRFANKYFDERQPWKEREDNPVSCEETIYNCIYLIAN
FANLLEPFLPFSSERVRSTLSIVNRNWEPQNTLPNRIDSVQPLFERIDVKQIEHEIEKLY
GAAK
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgagtatttttattggaggcgcttggccgtatgcaaatggctcgttacatcttggtcat
attgcgagtttgttacctggagatattttagcacgttattaccgggcaaaaggtgagaat
gtgttgtatgtttcgggcagtgattgtaatggaacaccgattgcaattagagcaaaacaa
gaaggtgtgacagcaaaagaaattgctaataagtaccatgaagaattccagcgatgtttt
cgtgatctcggttttacgtatgattgctatacacgtaccgatagcgagcatcatcatgaa
actgttcaaaaagtttttttacgtttattggaagaaggctatatttataaaaaaacagtg
gaacaagcgtactgtaaaacgtgtacgcagtttttaccggatcgttatgtagaaggaata
tgtccacattgccatgaagcagcaagaggcgatcaatgcgatgcgtgttcagctatttta
gatccactcgatttgttagaaaagacatgcaagttatgtggtagtacaccatctgtagag
gaaacagagcatttttattttgcattgcatacatttcagcagcaaattaaaaaagttgta
gaaatcgcaaaagaaaaaggaacatggcgtgataatgcaattcaattaacggaaagatat
gtaaaggaaggcttacaagatagggttgtatcaagagatttaccaatcggggtaccaatt
ccagtgaaagggtatgaagataagaaaatttacgtatggatagaagcagtggcaggatat
tattcagcgagtaaatattgggctgaagaaacaggaaaagatgatcatgagttttggaat
agcgatgcgcaaacatattatgtacacggcaaggataatattccatttcactccatcatt
tggccagcggttttacttggaataggagaggaagcaatcccgcgtcatatcgtttcgaat
gagtatttaacagttgaaaaaagaaagttatctacgagtaaaaactgggcagtatgggtg
cctgacatattagaacgttacaatccagattctattcgttactttttaacagtaaatgca
ccagaaaatcgtgatactgatttttcatggcgtgaattcatttacagtcataatagtgaa
ctgttaggtgcatacgggaacttcgtgaaccggacattaaagtttattgaaaaatattat
gatggcattgtgccgcagggaactatcaatgtagaactgaaggataaagtagaaggatta
tataaaaatgtaggagaggcgattgagcaaactacatttaaggtggcgctagaaacaata
ttcgatgccgtacgttttgcaaataaatactttgatgagagacagccttggaaagaaaga
gaagataatccagtttcatgtgaagaaacgatttataattgtatttatcttattgctaat
tttgcaaatctccttgaaccatttttaccattttcaagtgaaagagttcgaagcacattg
tcgattgtgaaccgaaattgggaaccgcaaaatacgttgccgaatagaattgatagcgtg
cagccattatttgagcgaatcgatgtaaaacaaattgagcatgagatagagaagctgtat
ggagcggcaaaatga

DBGET integrated database retrieval system