KEGG   Bacillus cereus G9842: BCG9842_B0184Help
Entry
BCG9842_B0184     CDS       T00815                                 

Gene name
gtaB
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bcg  Bacillus cereus G9842
Pathway
bcg00040  Pentose and glucuronate interconversions
bcg00052  Galactose metabolism
bcg00500  Starch and sucrose metabolism
bcg00520  Amino sugar and nucleotide sugar metabolism
bcg01100  Metabolic pathways
bcg01130  Biosynthesis of antibiotics
Module
bcg_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bcg00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BCG9842_B0184 (gtaB)
   00052 Galactose metabolism
    BCG9842_B0184 (gtaB)
   00500 Starch and sucrose metabolism
    BCG9842_B0184 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    BCG9842_B0184 (gtaB)
Enzymes [BR:bcg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BCG9842_B0184 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ACK97185
UniProt: B7IMT7
Position
complement(4828911..4829801)
Genome map
AA seq 296 aa AA seqDB search
MMKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAVKSGIEDIIIVTGK
TKRSIEDHFDNAFELEQNLLEKKKYELLEKVQASSKMVDIHYIRQKEPKGLGHAVWCARK
FIGDEPFAVLLGDDIVQAEKPCLRQLMDEYEKTLSSVIGVQTVPETETHRYGIIDPLEQE
GRRYQVRNFVEKPAQGTAPSNLAIMGRYILTPEIFMFLEQQHVGAGGEIQLTDAIQSLNE
IQRVFAYDFEGKRYDVGEKLGFVQTTIEMALQHPELRDDMVAMMKKILEEQANQES
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
gtgatgaaaaaagtaagaaaagcgataatcccagcagctggattaggaacacgtttttta
ccagcaacgaaagcaatgccgaaagaaatgttaccgatagtagataaaccaacgattcaa
tacattgtagaagaagcagtgaaatcgggaatcgaagatattattatcgttactggtaaa
acaaagcgctctatcgaagatcattttgataacgcatttgaactagaacaaaacttatta
gagaagaaaaaatatgagttgcttgaaaaagtacaagcttcttcaaaaatggtagatatt
cattacatccgtcaaaaagagccgaagggactaggacatgctgtttggtgtgcacgtaaa
ttcattggtgatgagccatttgcagtgttactaggtgatgatattgtccaagctgagaaa
ccatgtttacgtcaattaatggatgagtatgaaaaaacactttcttctgttattggtgta
caaactgttccagaaacagaaacacaccgttacggaattatcgatccattagaacaagaa
ggtcgtcgttaccaagttcgcaatttcgttgagaaaccagcacaaggtacagcaccttca
aacttagcgattatgggccgttacattttaacgcctgaaatctttatgttcttagaacag
caacatgtcggtgctggcggtgaaattcagttaacagatgcaatccaaagcttaaatgaa
atccaacgtgtatttgcttacgatttcgaaggaaagcgctacgatgtaggtgaaaagcta
ggattcgttcaaacgacaattgaaatggccctgcaacacccagaattacgtgatgacatg
gttgcgatgatgaagaaaattttagaagaacaagcgaatcaagagtcttaa

DBGET integrated database retrieval system