KEGG   Bacillus cereus G9842: BCG9842_B1167Help
Entry
BCG9842_B1167     CDS       T00815                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase complex E2 component, dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bcg  Bacillus cereus G9842
Pathway
bcg00010  Glycolysis / Gluconeogenesis
bcg00020  Citrate cycle (TCA cycle)
bcg00620  Pyruvate metabolism
bcg01100  Metabolic pathways
bcg01110  Biosynthesis of secondary metabolites
bcg01120  Microbial metabolism in diverse environments
bcg01130  Biosynthesis of antibiotics
bcg01200  Carbon metabolism
Module
bcg_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bcg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCG9842_B1167 (pdhC)
   00020 Citrate cycle (TCA cycle)
    BCG9842_B1167 (pdhC)
   00620 Pyruvate metabolism
    BCG9842_B1167 (pdhC)
Enzymes [BR:bcg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BCG9842_B1167 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H NUP50
Motif
Other DBs
NCBI-ProteinID: ACK97435
UniProt: B7IVK7
Position
complement(3956063..3957352)
Genome map
AA seq 429 aa AA seqDB search
MAFEFKLPDIGEGIHEGEIVKWFIKPGDEVNEDDVLLEVQNDKAVVEIPSPVKGKVLEVL
VEEGTVAIVGDTLIKFDAPGYENLKFKGDDHDEAPKAEEAAVEAPAAEATPAATAEVVNE
RVIAMPSVRKYAREKGVDIHKVAGTGKNGRIVKADIDAFANGGQTVAATEAPAAVEATPA
AAKEEAPKAQPIPAGEYPETREKMSGIRKAIAKAMVNSKHTAPHVTLMDEVDVTELVAHR
KKFKAVAADKGIKLTYLPYVVKALTSALREYPMLNTSLDDASQEVVHKHYFNIGIAADTD
KGLLVPVVKDTDRKSIFTISNEINDLAGKAREGRLAPTEMKGASCTITNIGSAGGQWFTP
VINHPEVAILGIGRIAEKPVVKNGEIVAAPVLALSLSFDHRLIDGATAQKALNQIKRLLN
DPQLLVMEA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttaaactaccagatatcggtgaaggtatccacgaaggtgaaatcgta
aaatggtttattaaaccaggcgatgaagtaaatgaagacgatgtacttcttgaagtacaa
aatgataaagcagtagtagaaatcccttctcctgttaaaggtaaagtacttgaagtactt
gtagaagaaggaacagttgcaatcgtaggagatacattaattaaatttgatgctcctgga
tacgaaaaccttaaatttaaaggtgacgatcatgatgaagctccaaaagctgaagaagca
gcagtagaagctccagcagcggaagctactccagcagcaactgcagaagtagtaaatgag
cgcgtaatcgctatgccatctgttcgtaaatacgctcgtgaaaaaggtgtagacattcat
aaagtagctggtactggtaagaacggccgtatcgtaaaagctgacatcgatgcatttgca
aatggtggacaaactgtagcagcaactgaggctccagcagcagtagaagctactccagca
gcagcgaaagaagaagcaccaaaagcacaaccaattccagctggtgaatatccagaaact
cgtgagaaaatgagtggtatccgtaaagcgattgcgaaagcaatggttaactctaaacac
acagctcctcacgtaacattaatggatgaagttgatgtaactgagcttgttgctcaccgt
aagaagttcaaagcagtagcagctgacaaaggtattaaattaacttaccttccatacgtt
gttaaagctttaacatctgcattacgtgaatacccaatgttaaacacttctttagacgat
gcatctcaagaagtagttcataaacattacttcaacatcggtatcgcagctgatacagac
aaaggtctattagtaccagttgttaaagatacagatcgtaagtctatcttcactatttct
aacgagatcaacgatcttgctggtaaagcacgtgaaggtcgtctagctccaactgaaatg
aaaggtgcttcttgcacaattacaaacattggttctgcaggtggacaatggttcactcca
gttatcaatcacccagaagtagcaatccttggtatcggccgtatcgctgaaaaaccagtt
gtgaaaaatggcgagatcgttgcagctccagtattagcattatctctaagctttgaccat
cgtttaattgacggcgcaactgctcaaaaagcgttaaaccaaattaaacgtctattgaat
gacccacaattattagtaatggaggcgtaa

DBGET integrated database retrieval system