KEGG   Bacillus cereus G9842: BCG9842_B1313Help
Entry
BCG9842_B1313     CDS       T00815                                 

Gene name
gid
Definition
(GenBank) gid protein
  KO
K04094  methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase [EC:2.1.1.74]
Organism
bcg  Bacillus cereus G9842
Brite
KEGG Orthology (KO) [BR:bcg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bcg03016]
    BCG9842_B1313 (gid)
   03036 Chromosome and associated proteins [BR:bcg03036]
    BCG9842_B1313 (gid)
Enzymes [BR:bcg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.74  methylenetetrahydrofolate---tRNA-(uracil54-C5)-methyltransferase (FADH2-oxidizing)
     BCG9842_B1313 (gid)
Transfer RNA biogenesis [BR:bcg03016]
 Prokaryotic type
  tRNA modification factors
   Methyltransferases
    BCG9842_B1313 (gid)
Chromosome and associated proteins [BR:bcg03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    BCG9842_B1313 (gid)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GIDA NAD_binding_8 Pyr_redox_2 DAO 3HCDH_N FAD_binding_2 AlaDh_PNT_C Pyr_redox HI0933_like Pyr_redox_3 FAD_binding_3 FAD_oxidored Thi4 Peptidase_C8
Motif
Other DBs
NCBI-ProteinID: ACK96394
UniProt: B7IUJ1
Position
complement(3817383..3818687)
Genome map
AA seq 434 aa AA seqDB search
MTTQVVNVIGAGLAGSEAAYQIAKRGVQVRLYEMRPVRQTPAHHTDKFAELVCSNSLRAN
TLTNAVGVIKEEMRLMDSVIIRAADECSVPAGGALAVDRHEFAAKVTEYVKNHPNVTVVN
EELTEIPEGPTIIATGPLTSPDLAAQLKELTGEDYFYFYDAAAPIVEKDSIDMNKVYLKS
RYDKGEAAYLNCPMTEEEFDRFYEALIAAETVPLKEFEKEIFFEGCMPVEVMASRGRQTL
VFGPMKPVGLEDPKTGKTPYAVVQLRQDDAAGTLYNIVGFQTHLKWGPQKEVLQLIPGLE
NAEIVRYGVMHRNTFINSPNLLRPTYQYKQRDDLFFAGQMTGVEGYVESAASGLLAGINA
ARLVQGEEPVVLPSVTAMGSMANYITATNAKNFQPMNANFGLFAPLEKKIKKKAERNEAY
ATRALETIQNFVNI
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgacaacacaagtagtaaacgtcattggcgcaggtcttgcaggaagtgaagcggcttac
caaattgcaaaacgtggtgtccaagttagattatatgaaatgaggccggtaaggcaaacg
ccagctcatcacacagataaatttgctgaattagtatgtagtaactcacttcgtgcaaac
actttaacaaatgcagttggagttattaaagaggaaatgcgtttaatggattctgtaatt
attcgtgcggcagatgagtgctctgtaccagctggaggtgcgttagctgtagaccgtcat
gagttcgcagctaaagtaacagaatacgtaaaaaaccatccgaatgtaacggtagtgaac
gaagagcttactgaaattccagaaggaccaacaattattgcaacaggtccacttacatct
cctgatcttgctgcacaattaaaagaactaacaggtgaagattatttctatttctacgat
gcggcagcaccaatcgtagaaaaagacagtattgacatgaataaagtatatttaaaatcg
cgttatgacaaaggggaagctgcatatttaaattgcccaatgacagaagaagagtttgac
cgtttttatgaggctttaattgctgctgagacagtgcctttaaaagagtttgaaaaagaa
attttctttgaaggttgtatgccagtagaagttatggcaagtagagggagacagacgcta
gtatttggacctatgaaacctgttggattggaagatccaaaaacagggaaaacgccatat
gctgttgttcagttacgtcaagatgatgcagcaggaactttatacaatatcgtaggtttc
caaacgcatttaaagtggggaccacaaaaagaagtgctacagttaataccgggactggaa
aatgcagagattgtacgttatggtgtaatgcatcgtaatacgtttattaattcacctaat
ttgcttcgtccaacatatcaatataaacaacgtgatgatttattcttcgctggtcaaatg
actggagtagagggatatgttgaatcagcagcatcaggattattagcaggaattaatgct
gcacgtcttgtgcaaggtgaagagccagttgtattaccgtcagtaactgcgatgggcagc
atggcaaattacattacggcaacgaacgctaaaaacttccaaccgatgaatgcgaacttc
ggtctatttgcaccgttagagaagaagatcaaaaagaaagcggaacgaaatgaagcatac
gcaacacgcgctttagaaacaattcaaaattttgtaaatatttag

DBGET integrated database retrieval system