KEGG   Bacillus cereus G9842: BCG9842_B1582Help
Entry
BCG9842_B1582     CDS       T00815                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bcg  Bacillus cereus G9842
Pathway
bcg00071  Fatty acid degradation
bcg00072  Synthesis and degradation of ketone bodies
bcg00280  Valine, leucine and isoleucine degradation
bcg00310  Lysine degradation
bcg00362  Benzoate degradation
bcg00380  Tryptophan metabolism
bcg00620  Pyruvate metabolism
bcg00630  Glyoxylate and dicarboxylate metabolism
bcg00640  Propanoate metabolism
bcg00650  Butanoate metabolism
bcg00900  Terpenoid backbone biosynthesis
bcg01100  Metabolic pathways
bcg01110  Biosynthesis of secondary metabolites
bcg01120  Microbial metabolism in diverse environments
bcg01130  Biosynthesis of antibiotics
bcg01200  Carbon metabolism
bcg01212  Fatty acid metabolism
bcg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bcg00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCG9842_B1582
   00630 Glyoxylate and dicarboxylate metabolism
    BCG9842_B1582
   00640 Propanoate metabolism
    BCG9842_B1582
   00650 Butanoate metabolism
    BCG9842_B1582
  Lipid metabolism
   00071 Fatty acid degradation
    BCG9842_B1582
   00072 Synthesis and degradation of ketone bodies
    BCG9842_B1582
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BCG9842_B1582
   00310 Lysine degradation
    BCG9842_B1582
   00380 Tryptophan metabolism
    BCG9842_B1582
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BCG9842_B1582
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCG9842_B1582
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BCG9842_B1582
Enzymes [BR:bcg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BCG9842_B1582
Exosome [BR:bcg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BCG9842_B1582
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACK93301
UniProt: B7ISG6
Position
complement(3564293..3565384)
Genome map
AA seq 363 aa AA seqDB search
MNRAVIVEAKRTPIGKKNGMLKEYEVQQLVTPLLTFLSKGIEREIDDVMLGNIVGPGGNI
ARLSALEAGLGYHIPGVTIDRQCGAGLEAIRTACHLIQGGAGKCYIAGGVESTSTSPFQK
RARFSPETIGDPDMGVAAEYVAERYNITREMQDEYACLSYKRTLQALEKGYIHDEIFSFN
GLLDESIKLEMNYERIIKRTKPAFLQNGTVTAGNSCGVNDGACAVLVMEEGQARKLGYKP
VLRFVRSAVVGVDPKLPGTGPIFAVNKLLNEMNVKVEDIDYFEINEAFASKVVACAKELQ
IPYEKVNVNGGAIALGHPYGASGAMLVTRLFYQAQRESMKYGIATLGIGGGIGIALLFEK
VED
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaatagagcagttattgtagaggcgaaaagaacacctatcggtaagaagaatgggatg
ttaaaagagtatgaagttcagcaattagtaacgccgcttcttacgtttttaagtaaaggg
attgagagagaaatagacgatgtcatgttagggaatattgtggggccaggagggaatatt
gcgagactatctgctttagaggcgggacttggctatcatattcctggtgtaacgattgat
cggcaatgtggtgctggtttagaagcaattcgaactgcgtgtcatctcattcaaggcggg
gcaggtaagtgttatatcgccgggggagtagagagtacaagtacgtcaccttttcaaaaa
agagcacgattttcacctgaaacaattggtgatcctgacatgggagtagcggctgaatat
gttgcggagcgttataacataacgagagaaatgcaagacgagtatgcttgtcttagttat
aagcggacactgcaagcgttagaaaaaggatatatacatgatgaaatattttcttttaat
ggattattagatgaatctataaagctagaaatgaattatgaacgaatcattaaaagaaca
aagcccgcatttttacaaaatggaacagtaacggcaggtaattcgtgcggtgtaaatgat
ggagcatgtgccgttcttgtaatggaagagggacaagcccgaaagttaggttataaacct
gtccttcgtttcgttcgtagtgctgtagtgggagtggatcccaagcttccagggactggt
ccgatatttgcggtgaacaaattattaaacgaaatgaatgtaaaagtagaggacatcgat
tattttgaaataaatgaagcattcgcctcaaaagttgttgcttgcgcaaaagagttacaa
attccgtacgaaaaagtaaatgtaaatggtggagcaattgcgctcggtcatccgtacggt
gcatctggtgctatgcttgtaacacgtttgttttatcaggcacaaagagagtctatgaaa
tatggaattgctacattaggaattggaggcgggatagggattgcgctattatttgagaaa
gtagaagactag

DBGET integrated database retrieval system