KEGG   Bacillus cereus G9842: BCG9842_B2251Help
Entry
BCG9842_B2251     CDS       T00815                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
bcg  Bacillus cereus G9842
Pathway
bcg00330  Arginine and proline metabolism
bcg00332  Carbapenem biosynthesis
bcg01100  Metabolic pathways
bcg01130  Biosynthesis of antibiotics
bcg01230  Biosynthesis of amino acids
Module
bcg_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bcg00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BCG9842_B2251 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    BCG9842_B2251 (proB)
Enzymes [BR:bcg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     BCG9842_B2251 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ACK98201
UniProt: B7ILK2
Position
complement(2903279..2904382)
Genome map
AA seq 367 aa AA seqDB search
MKKQRIVVKIGSSSLADSHGGISTEQLSDHVAALARLKEEGHEVVLITSGAVAAGFSALG
YPSRPVTIKGKQAAAAVGQSLLMQAYTEEFRKYGIVTAQLLLTRSDFSRKEQYSNAYATL
GELLNRSALPIINENDSISLEELTFGDNDMLSALVSGLVSADMLMIFTDVNGLYDKNPQK
NADAKKYYFLPEVTEEISSLAGDAGSKLGTGGMKSKIDAAKTALSLGVSVFIGTGRGQEK
FVDVLKGKGDGTYVGNAPQKEMKMNKQWIALHSLVSGQIEVDAGAATAIIQHGKSLLPAG
VTNVSGFFQVGEVVEVVTQQGRVIGKGQCTYSAEELRDVKGMQSQDIQVRGERHSYEVIH
RDHWVSL
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaacaacgaattgttgtaaagattggaagtagttccttggcagatagtcacgga
ggcatctctacagaacagctttcagatcacgttgccgcattggctcggttgaaagaggaa
gggcacgaggttgtgttaattacatctggagccgtcgctgcaggtttttcagcgctagga
tatcctagtagacctgtaacgattaaagggaaacaggctgcagcagctgtcggacaaagt
ttgttaatgcaggcgtacacggaggaattccgtaaatatggcatcgttactgcgcaactt
ttgctgacgagaagtgatttttctagaaaagaacaatatagtaatgcttacgctacgtta
ggagaattactaaaccgttccgctcttccaattattaatgaaaatgattccatctcttta
gaggagctgacgttcggtgataatgatatgctgtcagctttagtaagcgggcttgtttcg
gcggatatgcttatgatctttacggatgtgaacgggttatatgacaaaaatcctcagaaa
aatgcggatgcaaaaaaatattattttcttcctgaagttacggaagaaatttcttctctt
gcaggagatgctggctcaaaacttgggactggtggtatgaaatcaaaaatcgatgctgca
aagacagcactctctcttggtgtgagtgtatttatcgggacaggacgtggacaggaaaag
tttgtagatgttttgaagggtaagggtgatggaacgtatgttggtaatgctcctcaaaaa
gaaatgaagatgaacaagcaatggattgccctgcattcgcttgttagcggacaaattgaa
gtagatgctggggcggctactgccatcattcagcatggtaagagtttacttccagctggt
gttacgaatgtatcaggatttttccaagtgggtgaagttgtagaggttgtaacgcaacaa
gggcgcgtaataggaaaaggacaatgcacatatagtgcagaggaactaagagatgtaaaa
ggtatgcaaagccaagatattcaagtaagaggcgagagacatagttatgaagtcattcat
agagatcattgggtttcactttaa

DBGET integrated database retrieval system