KEGG   Bacillus cereus G9842: BCG9842_B2893Help
Entry
BCG9842_B2893     CDS       T00815                                 

Gene name
gpm
Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bcg  Bacillus cereus G9842
Pathway
bcg00010  Glycolysis / Gluconeogenesis
bcg00260  Glycine, serine and threonine metabolism
bcg00680  Methane metabolism
bcg01100  Metabolic pathways
bcg01110  Biosynthesis of secondary metabolites
bcg01120  Microbial metabolism in diverse environments
bcg01130  Biosynthesis of antibiotics
bcg01200  Carbon metabolism
bcg01230  Biosynthesis of amino acids
Module
bcg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bcg_M00002  Glycolysis, core module involving three-carbon compounds
bcg_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCG9842_B2893 (gpm)
  Energy metabolism
   00680 Methane metabolism
    BCG9842_B2893 (gpm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCG9842_B2893 (gpm)
Enzymes [BR:bcg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BCG9842_B2893 (gpm)
Membrane trafficking [BR:bcg04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BCG9842_B2893 (gpm)
Exosome [BR:bcg04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BCG9842_B2893 (gpm)
  Exosomal proteins of melanoma cells
   BCG9842_B2893 (gpm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 MIF4G_like
Motif
Other DBs
NCBI-ProteinID: ACK96831
UniProt: B7IX37
Position
2288779..2289516
Genome map
AA seq 245 aa AA seqDB search
MIKLVLIRHGQSLWNLENRFTGWTDVDLSENGLSEAREAGAILKKNRYTFDVAYTSVLKR
AIRTLWIVLHEMDLTWVPIHKSWKLNERHYGALQGLNKDETAQKYGEEQVHIWRRSVDVR
PPALTEDDPRYEATDPRYKTLKKGEFPLTECLEDTEKRVLAYWHSEIAPILKNGNKVIIS
SHGNTIRSLVKYLDNLSSDGVVSLNIPTSIPLVYELDENLRPIRHYYLSMDGEVPEGEIP
KHISF
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgataaaacttgtacttattcgtcacggacaaagtttatggaatcttgaaaatcgcttt
actggatggacagatgttgatctatcagagaatggattaagtgaagcgagagaagcagga
gcaatattaaagaaaaacagatatacttttgatgtggcttatacatctgtattaaaacgc
gcaattcggacgttatggattgtacttcatgagatggatcttacttgggtcccaatacat
aaatcttggaagctaaatgaaagacattatggtgcattgcaggggttgaataaagatgaa
actgctcaaaaatatggtgaggagcaagttcatatttggagaagaagtgttgatgtaaga
ccaccggctcttactgaagacgatcctcgatatgaagcgaccgatccaagatataaaaca
ctcaaaaaaggtgaatttccattaactgaatgtttagaggatacggagaagagagtactt
gcttattggcactcagaaattgcgccgatattaaaaaatggtaataaagtaattatttca
tcacacggtaacacaattcgctcgctagtaaaatacttagacaacctttcgagtgatggt
gtagtttcattaaatattccaactagtattccgcttgtttatgaattagacgaaaactta
cgtccgattcgtcattattatttaagtatggatggagaagtacctgaaggggaaattccg
aaacatatttctttttaa

DBGET integrated database retrieval system