KEGG   Bacillus cereus G9842: BCG9842_B3581Help
Entry
BCG9842_B3581     CDS       T00815                                 

Definition
(GenBank) phosphoglycerate mutase family protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bcg  Bacillus cereus G9842
Pathway
bcg00010  Glycolysis / Gluconeogenesis
bcg00260  Glycine, serine and threonine metabolism
bcg00680  Methane metabolism
bcg01100  Metabolic pathways
bcg01110  Biosynthesis of secondary metabolites
bcg01120  Microbial metabolism in diverse environments
bcg01130  Biosynthesis of antibiotics
bcg01200  Carbon metabolism
bcg01230  Biosynthesis of amino acids
Module
bcg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bcg_M00002  Glycolysis, core module involving three-carbon compounds
bcg_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCG9842_B3581
  Energy metabolism
   00680 Methane metabolism
    BCG9842_B3581
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCG9842_B3581
Enzymes [BR:bcg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BCG9842_B3581
Membrane trafficking [BR:bcg04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BCG9842_B3581
Exosome [BR:bcg04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BCG9842_B3581
  Exosomal proteins of melanoma cells
   BCG9842_B3581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACK96197
UniProt: B7IR52
Position
1624624..1625199
Genome map
AA seq 191 aa AA seqDB search
MTTIYFVRHAHSTYTKEERERPLSEKGHCDAENVTHLLKDKHIDVVISSPYKRAIQTVQG
IANTYKLLIQTEEDLRERLLSTEPVADFNVAMQNVWKDWSFAYEGGESSDVAQRRAVICM
QNILKQYEGKNIVIGTHGNIMVLLMNYFNSKYDFEFWKTLHMPDVYKLNFDKNRFISAER
IEKTGHRLNIL
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgacgacaatctatttcgttcgccatgcccactctacatatacaaaagaagaaagggaa
cgacctttatctgaaaaagggcactgtgatgcagagaatgtaacgcatttattaaaagat
aaacatattgatgttgttatttctagtccgtacaaaagagcgatccaaactgtacaagga
attgcgaatacatataaattattaatacaaacagaagaagatttgcgtgaaagattattg
agtacagagccagtagcagattttaatgttgctatgcagaatgtgtggaaagattggagt
tttgcatacgaaggcggagaatcgagtgatgtcgcacaaaggcgcgctgtaatatgtatg
caaaatatattaaaacaatatgaaggtaagaacattgtaataggtacgcatgggaatatt
atggtattactaatgaattattttaattcgaaatatgattttgagttttggaaaacactt
catatgcctgatgtgtataaattaaattttgataaaaatcgcttcatttctgctgaaaga
atagagaaaacaggtcatcggttaaatattttgtaa

DBGET integrated database retrieval system