KEGG   Bacillus cereus G9842: BCG9842_B3861Help
Entry
BCG9842_B3861     CDS       T00815                                 

Definition
(GenBank) siroheme synthase, precorrin 2 oxidase and ferrochelatase domains
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
bcg  Bacillus cereus G9842
Pathway
bcg00860  Porphyrin and chlorophyll metabolism
bcg01100  Metabolic pathways
bcg01110  Biosynthesis of secondary metabolites
bcg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BCG9842_B3861
Enzymes [BR:bcg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     BCG9842_B3861
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     BCG9842_B3861
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 Sirohm_synth_M Shikimate_DH Pyr_redox_2 TrkA_N CoA_binding_2 Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ACK98236
UniProt: B7INC1
Position
1363673..1364287
Genome map
AA seq 204 aa AA seqDB search
MYPLTVRVNEKRVVVIGGGKVAGFKIIPLLKQGADIVVISPELDANLVKLVEEKKIRWYQ
REYEKSDIKSAFLVVAASSDSILNEQVAEDAAENQLVNVITNPESGNVHFPAAIHRGLLN
IAVSTGGASPKLAKKIRDEIANKYDETYESYLDFLYEVRVKLKDLQLEKRERNILLQEVL
KSVYMQNEGKRESFLRELEEKVLK
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgtatccacttacagtgcgagttaatgagaaacgtgttgttgttattggtgggggaaaa
gttgcaggatttaaaattattcctttactcaaacaaggtgcagatatagttgtaatcagt
ccagaattagatgcgaatttagtaaaacttgtggaagaaaagaaaattcgttggtatcaa
agagaatatgaaaaaagtgatattaaaagtgcttttttagttgttgcagcgagtagtgat
tcaatattaaatgaacaagttgctgaagatgccgcggagaatcaattagtaaatgttatt
acaaatccggaaagtggtaatgttcattttccggcagcgattcatcgtggtttgcttaat
atagcagtttctactgggggagcgagcccgaagctcgcaaaaaaaattcgagatgagatt
gcaaataaatatgatgagacatatgaatcgtatttagattttttatatgaagtaagggtg
aagttaaaagatttacagttagaaaagagggaacgaaatatattgctccaggaagtgttg
aaatcagtatatatgcaaaacgaggggaaaagagaaagttttttgcgagaattagaggaa
aaggttttaaaataa

DBGET integrated database retrieval system