KEGG   Bacillus cereus G9842: BCG9842_B5485Help
Entry
BCG9842_B5485     CDS       T00815                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bcg  Bacillus cereus G9842
Pathway
bcg00071  Fatty acid degradation
bcg00072  Synthesis and degradation of ketone bodies
bcg00280  Valine, leucine and isoleucine degradation
bcg00310  Lysine degradation
bcg00362  Benzoate degradation
bcg00380  Tryptophan metabolism
bcg00620  Pyruvate metabolism
bcg00630  Glyoxylate and dicarboxylate metabolism
bcg00640  Propanoate metabolism
bcg00650  Butanoate metabolism
bcg00900  Terpenoid backbone biosynthesis
bcg01100  Metabolic pathways
bcg01110  Biosynthesis of secondary metabolites
bcg01120  Microbial metabolism in diverse environments
bcg01130  Biosynthesis of antibiotics
bcg01200  Carbon metabolism
bcg01212  Fatty acid metabolism
bcg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bcg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCG9842_B5485
   00630 Glyoxylate and dicarboxylate metabolism
    BCG9842_B5485
   00640 Propanoate metabolism
    BCG9842_B5485
   00650 Butanoate metabolism
    BCG9842_B5485
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BCG9842_B5485
   00072 Synthesis and degradation of ketone bodies
    BCG9842_B5485
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BCG9842_B5485
   00310 Lysine degradation
    BCG9842_B5485
   00380 Tryptophan metabolism
    BCG9842_B5485
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BCG9842_B5485
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCG9842_B5485
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BCG9842_B5485
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bcg04147]
    BCG9842_B5485
Enzymes [BR:bcg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BCG9842_B5485
Exosome [BR:bcg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BCG9842_B5485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III Ribosomal_S16
Motif
Other DBs
NCBI-ProteinID: ACK96650
UniProt: B7IQZ7
Position
complement(5212884..5214167)
Genome map
AA seq 427 aa AA seqDB search
MYTTLERGAMIAPLLNVGIPSERSVLKNEMGERNMSKTVILSAARTPVGRFGGSLKDVKA
TELGGIAIKAALERANVAASDVEEVIFGTVIQGGQGQIPSRQAARAAGIPWEVQTETVNK
VCASGLRAVTLADQIIRTGDQSLIVAGGMESMSNSPYILRGARWGYRMGNNEVIDLNVAD
GLTCAFSGTHMGVYGGEVAKEDGISREAQDEWAYRSHQRAVSAHKEGRFEEEIVPVTIPQ
RKGDSIVVAKDEAPREDTTIEKLAKLKPVFDKTAAVTAGNAPGLNDGGAALVLMSEDRAK
QEGRKPLATILAHTAIAVESKDFPRTPGYAINALLEKTGKTIEDIDLFEINEAFAAVAIA
STEIAGIDPEKLNVNGGAVAMGHPIGASGARIIVTLIHALKQRGGGIGIASICSGGGQGD
AVMIEVH
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgtatacaactttagaaagaggtgcaatgattgcacctcttctcaacgtagggataccg
agcgagcgctcagtgttaaaaaatgaaatgggggaaagaaacatgagtaaaacagttatt
ttaagtgctgcaagaacaccagttggaagattcggaggatctttaaaagatgtaaaagcg
acggaacttggaggaattgcaattaaagcagcgcttgaaagagcaaatgttgcagctagt
gatgttgaagaagttatatttggaacggttattcaaggtggacagggacaaattccatcg
cgccaagctgcaagggctgcaggaatcccttgggaagtgcagacggaaacagtcaataaa
gtttgtgcatcaggccttcgtgcggttacgttagcggatcagattattcgtactggcgat
caatcactgattgtagctggtggtatggagtcgatgagtaacagtccttacattttacgc
ggagcaagatggggatacagaatgggcaacaacgaagttattgatttaaacgttgctgac
ggtttaacatgcgcattttcaggtacacacatgggtgtttatggcggagaagttgcgaag
gaagatggaatttctcgcgaagcgcaagatgaatgggcatatcgtagccatcagcgtgcg
gtttcagcgcataaagaaggacgttttgaagaggagatcgttccagtaacgatcccgcaa
agaaaaggcgattctattgtcgttgcaaaggatgaggcgccacgtgaagatacaacgatt
gaaaagttagcaaagttaaaacctgtatttgataagacagcggcggtgacagctggtaat
gcgccaggcttgaacgatggtggtgccgcacttgtattaatgagcgaagacagagcgaag
caagaaggaagaaagccattagcgacaattttggcgcatacagcaattgcagtggaatct
aaagatttcccaagaacgccaggttatgcaattaacgcattgcttgaaaaaacaggcaag
acaattgaagatatcgatttattcgagattaatgaagcatttgcagcggtagcaattgca
agtacagaaatcgcaggaattgatccagaaaaattgaatgtaaatggcggcgcagtagcg
atgggacatccaattggagcaagcggagcgcgcattatcgttacactaatccatgcgctt
aagcagcgcggcggcggaattggaattgcttcgatttgtagcggtggcggtcaaggggac
gcagtgatgattgaagttcactaa

DBGET integrated database retrieval system