KEGG   Bacillus cereus G9842: BCG9842_B5701Help
Entry
BCG9842_B5701     CDS       T00815                                 

Gene name
tpi
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bcg  Bacillus cereus G9842
Pathway
bcg00010  Glycolysis / Gluconeogenesis
bcg00051  Fructose and mannose metabolism
bcg00562  Inositol phosphate metabolism
bcg01100  Metabolic pathways
bcg01110  Biosynthesis of secondary metabolites
bcg01120  Microbial metabolism in diverse environments
bcg01130  Biosynthesis of antibiotics
bcg01200  Carbon metabolism
bcg01230  Biosynthesis of amino acids
Module
bcg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bcg_M00002  Glycolysis, core module involving three-carbon compounds
bcg_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCG9842_B5701 (tpi)
   00051 Fructose and mannose metabolism
    BCG9842_B5701 (tpi)
   00562 Inositol phosphate metabolism
    BCG9842_B5701 (tpi)
Enzymes [BR:bcg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BCG9842_B5701 (tpi)
Exosome [BR:bcg04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BCG9842_B5701 (tpi)
  Exosomal proteins of bladder cancer cells
   BCG9842_B5701 (tpi)
  Exosomal proteins of melanoma cells
   BCG9842_B5701 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACK98104
UniProt: B7IP22
Position
complement(5006026..5006781)
Genome map
AA seq 251 aa AA seqDB search
MRKPIIAGNWKMNKTLSEAVSFVEEVKGQIPAASAVDAVVCSPALFLERLVAATEGTDLQ
VGAQNMHFEKNGAFTGEISPVALSDLKVGYVVLGHSERREMFAETDESVNKKTLAAFEHG
LTPIVCCGETLEERESGKTFDLVAGQVTKALAGLTEEQVKATVIAYEPIWAIGTGKSSSS
ADANEVCAHIRKVVAEAVSPEAAEAVRIQYGGSVKPENIKEYMAQSDIDGALVGGASLEP
ASFLGLLGAVK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccaattatcgcaggtaactggaaaatgaataaaactctatctgaagcagtt
agcttcgtagaggaagttaaaggtcaaatcccagcagcttcagctgttgatgcagtagtt
tgctctccagctctattcttagagcgccttgtagcagcaactgaaggaactgatttacaa
gtaggtgcacaaaacatgcacttcgaaaaaaatggtgcattcactggcgaaattagccca
gtagcacttagcgacttaaaagtaggctacgtagtacttggccactctgagcgtcgtgaa
atgtttgctgaaacagacgaatcagtaaacaaaaagactctagcagcatttgaacatggt
ttaacaccaatcgtatgttgtggtgagactttagaagagcgcgaaagcggaaaaacattt
gatctagtagcaggtcaagtgacaaaagcacttgcaggtttaacagaagagcaagttaaa
gcaactgttatcgcttatgagcctatctgggctatcggtacaggtaaatcttcttcttct
gcagatgcaaatgaagtatgtgcgcacatccgtaaagttgttgcagaagctgtttctcca
gaagctgcagaagctgttcgtattcaatacggcggtagcgtaaaaccagaaaacattaaa
gagtatatggcacaatctgacatcgacggcgctttagttggcggtgctagcttagagcct
gcttcgttcttaggtcttctgggggcggtaaaatga

DBGET integrated database retrieval system