KEGG   Bacillus cereus G9842: BCG9842_B5708Help
Entry
BCG9842_B5708     CDS       T00815                                 

Gene name
estA
Definition
(GenBank) carboxylesterase
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
bcg  Bacillus cereus G9842
Brite
Enzymes [BR:bcg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     BCG9842_B5708 (estA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 DLH Peptidase_S9 UPF0227 DUF676 BAAT_C
Motif
Other DBs
NCBI-ProteinID: ACK95522
UniProt: B7IP15
Position
complement(4999534..5000277)
Genome map
AA seq 247 aa AA seqDB search
MMKLASPKPFTFEGGDRAVLLLHGFTGNSADVRMLGRFLEKKGYTCHAPIYKGHGVPPEE
LVHTGPTDWWQDVTEAYQLLKDKGFEKIAVVGLSLGGVFSLKLGYTVPVLGVVPMCAPMY
IKSEETMYQGILAYAREYKKREQKSPEQIEQEMLEFQKTPMNTLKALQQLIADVRNNVDM
IYAPTFVVQARHDEMINTDSANIIYNGVESTLKDIKWYEDSTHVITLDKQRDELHEDVYN
FLEQLDW
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaattagcatctccgaaaccatttacatttgagggtggagaccgcgctgtttta
ttactacatggattcacagggaactcagctgatgtacgtatgttagggcgtttcttagag
aagaaaggctacacttgtcatgcgccaatttataaagggcacggtgtaccaccagaagag
cttgttcatacaggccctacagattggtggcaagatgtaacggaggcatatcagctttta
aaagataaaggttttgagaaaattgctgttgttggattgtcacttggcggcgtattttct
ttaaaattaggttatacagtaccggttttaggtgtagtaccaatgtgtgcaccgatgtat
attaagagcgaagaaacgatgtaccaaggtatattggcatatgcccgcgaatataaaaag
cgtgagcaaaagtcaccagagcaaatcgaacaagaaatgttggaattccaaaagacaccg
atgaatacattaaaagcattacaacaattaattgctgacgtacgtaacaatgtggatatg
atttatgcaccaacatttgttgtacaagcacgtcatgacgaaatgattaatacagatagt
gctaacattatttataacggtgtagaatctacgttaaaagacattaaatggtatgaagac
tctacgcatgtcattacacttgataaacaacgtgacgagctacatgaggatgtatataac
ttcttggagcaactagattggtaa

DBGET integrated database retrieval system