KEGG   Burkholderia cenocepacia HI2424: Bcen2424_0274Help
Entry
Bcen2424_0274     CDS       T00415                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
bch00670  One carbon pool by folate
bch01100  Metabolic pathways
bch01120  Microbial metabolism in diverse environments
bch01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bch00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Bcen2424_0274
Enzymes [BR:bch01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     Bcen2424_0274
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: ABK07028
Position
1:315865..316695
Genome map
AA seq 276 aa AA seqDB search
MKPIELSFEFFPPKTADGVEKLRATRAQLLPLKPKFVSVTFGAGGSTQQGTLDTVLDMQK
DGLEAAPHLSCIGSSRDSLRAILDQYRSHGIRHIVALRGDLPSGMGEVGELRYASELVSF
IRAEHGDWFHIEVAGYPEYHPQSRSPKADLENFARKVKAGANSAITQYFFNADAYFRFVD
DARKLGVDVPIVPGIMPITNFSQLMRFSEMCGAEVPRWVARRLESFGDDRESIRAFGADV
VTNLCQRLIDAGVPGLHFYTLNLATATRTICERLAV
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgatcgaactctcgtttgaattcttcccgccgaagacggcggacggcgtcgaa
aagctgcgcgccacgcgcgcgcagctgctgccgctgaagccgaaattcgtctccgtgacg
ttcggcgccggcggctcgacgcagcagggcacgctcgataccgtgctcgacatgcagaag
gacggcctcgaggccgcgccgcacctgtcgtgcatcggctcgtcgcgcgacagcctgcgc
gcgatcctcgaccagtaccgctcgcacggcatccggcacatcgtcgcgctgcgcggcgac
ctgccgtcggggatgggcgaggtcggcgagctgcgctatgcgtccgagctcgtcagcttc
atccgcgccgagcatggcgactggttccacatcgaagtcgccggttatccggagtaccac
ccgcaatcgcgctcgccgaaggccgatctcgagaatttcgcgcgcaaggtgaaagccggc
gcgaattccgcgatcacgcagtacttcttcaacgcggacgcgtatttccgcttcgtcgac
gatgcgcgcaagctgggcgtggacgtgccgatcgtgccgggcatcatgccgatcacgaac
ttctcgcagctgatgcgcttctccgagatgtgcggcgccgaagtgccgcgctgggtcgcg
cgccggctcgagagcttcggcgacgatcgcgagtcgatccgcgcgttcggcgcggacgtc
gtcacgaacctgtgccagcgcctgatcgacgcgggcgtgccggggctgcatttctacacg
ctgaacttggcgaccgccacgcggacgatctgcgaacggctcgcggtgtaa

DBGET integrated database retrieval system