KEGG   Burkholderia cenocepacia HI2424: Bcen2424_0463Help
Entry
Bcen2424_0463     CDS       T00415                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11892  type VI secretion system protein ImpK
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
bch03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bch00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Bcen2424_0463
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bch02044]
    Bcen2424_0463
Secretion system [BR:bch02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Bcen2424_0463
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DotU
Motif
Other DBs
NCBI-ProteinID: ABK07217
Position
1:complement(514786..515568)
Genome map
AA seq 260 aa AA seqDB search
MSYAPSLFGDNVPPPLHSPASTDSAFQARSLLDLLYDGFFMLFLLKNKREPDSASEFSTR
IQEFLSDFERGAKKLNIAAEDVYGAKFAFCAAIDEMVLSSQFKIRADWERRPLQLVLFGE
QLAGEKFFQYLEECRAQGAARLQSLEVFHMCLLLGFQGKYLLEGPEKLAYLTARLGDEIA
HMKGKRAAFAPHWPLPDQIAHRLKREVPVWAIGTVFALVALLGYLGLNTYLKDKTLQALA
PYSQVIKVGPESANLTISLP
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgagctacgcgccttccctgttcggcgacaacgtgccgccgcccctgcatagcccggca
tcgacggactccgcgttccaggcccgctcgctgctcgatctgctgtacgacgggttcttc
atgctgtttctgctcaagaacaagcgggagccggacagcgccagcgagttcagcacgcgg
atccaggagttcctgtcggatttcgagcgcggcgcgaagaagctgaatatcgccgccgag
gacgtgtacggcgcgaagttcgcgttctgcgcggccatcgacgaaatggtgctgtcgtcg
cagttcaagatccgcgcggattgggaacgccggccgctgcagctcgtgctgttcggcgag
cagctcgcgggcgagaagttcttccagtatctcgaggagtgtcgtgcgcagggtgcggcg
cggctgcagtcgctcgaggtgtttcatatgtgcctgctgctcgggttccagggcaagtat
ctgctcgaagggccggagaagctcgcgtatctcaccgcgcggcttggggacgagatcgcg
catatgaagggcaagcgggctgcgtttgcgccgcattggccgctgccggatcagatcgcg
caccggttgaagcgggaggtgccggtttgggcgatcgggaccgtgttcgcgctcgttgcg
ttgcttgggtatctcgggctcaatacctatctcaaggacaagacgctgcaggcgttggcg
ccgtattcgcaagtcatcaaagtgggcccggagtcggctaatttgacgatttcgttgccg
taa

DBGET integrated database retrieval system