KEGG   Burkholderia cenocepacia HI2424: Bcen2424_0469
Entry
Bcen2424_0469     CDS       T00415                                 

Definition
(GenBank) protein of unknown function DUF796
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
bch03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bch00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Bcen2424_0469
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bch02044]
    Bcen2424_0469
Secretion system [BR:bch02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Bcen2424_0469
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: ABK07223
Position
1:520772..521275
AA seq 167 aa
MLHMHLQFGSPAVKGESADKDHQGWIELKSWDHSIVQPRSATASTAGGHTMTRCEHGDMI
FTKEIDSSSPLLYQHASGGTTFDEVTVHFSRADGEGKRVQYLEVKLKYVIISSIAPSVRE
EGLPLETFSLKYAAVQWKQTQQKIGGNQGGNTQGAWSLTKNDKTYAV
NT seq 504 nt   +upstreamnt  +downstreamnt
atgttacatatgcacttgcagtttggtagtcccgcggtgaagggcgagtccgcggataaa
gaccaccaaggctggatcgaactgaaatcgtgggatcactcgatcgttcagccgcgttcg
gcaaccgcatcgaccgctggcggtcacacgatgacgcgttgcgagcacggcgacatgatc
ttcacgaaggaaatcgattcgtcgagcccgctgctgtatcagcacgcttcgggcggtacc
acgttcgacgaagtgacggtccatttctcgcgcgcggacggtgaaggcaagcgcgtgcag
tatctggaagtcaagctcaagtacgtgatcatctcgagcatcgcgccgagcgttcgcgag
gaaggtctgccgctcgagacgttctcgctgaagtacgcagccgtgcagtggaagcaaacc
cagcagaagatcggcggcaaccagggcggcaacacgcaaggcgcctggagtctgacgaag
aacgacaagacctacgcggtctaa

DBGET integrated database retrieval system