KEGG   Burkholderia cenocepacia HI2424: Bcen2424_0471
Entry
Bcen2424_0471     CDS       T00415                                 

Definition
(GenBank) protein of unknown function DUF879
  KO
K11896  type VI secretion system protein ImpG
Organism
bch  Burkholderia cenocepacia HI2424
Brite
KEGG Orthology (KO) [BR:bch00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bch02044]
    Bcen2424_0471
Secretion system [BR:bch02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Bcen2424_0471
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: ABK07225
Position
1:521900..523735
AA seq 611 aa
MEELLPYYERELSFLRRYSRDFAERYPKIAARLALSGEHCEDPHVERMIESFALLGARIN
KKLDDDYPEFTEALLEVLYPHYLRPFPSCSIAQFTPASPGQQTEPVVIDRGTELKSRPIR
GVQCRFRTAYDVTLAPIRISEARYTPVALAPSATVLPSNATGVISITFESLAAQLDLGAL
KLSTLRAHLHGEQSFVAALTDCLFVNVLGAYVEPERNGRWTALRKLPIAQAGFAEDDALI
DYPAKSHPAYRLLTEYFAFPDKFDFVDFDLAAIARASGRCQRATLHLVLQDVRSDSHIAR
LLELLTASHFRLFCTPIVNLFRQHGEPIRITHRAVSYPVIAEARRAFAYEVYSIDSVKLV
RQQAHEESVIEFRPFYSLHHGESARIGHYWFARRNDWVAQKSPGYETEISIVDIDFEPTS
PQTDTLSLDLTCTNRDLPSMLAFGLEGGDLFQEGGAQTSGISLLRRPTQSVRFERGRAAH
WRLVSHLALNHVSLVAHGLAPLKEMLTLYDLRRTAVSMRQIDGLAGVEQRGAVQWLPGKP
FATFVRGIEIRLTIDEEHFVGASLASFVRVLDSFFGLYVHLNSFVQLVVVSKRTGEEIIR
CKPRTGESILA
NT seq 1836 nt   +upstreamnt  +downstreamnt
atggaagaattgctgccgtattacgaacgcgaattatcgtttttgcggcgctattcgcga
gatttcgccgaacgctatccgaagatcgccgcgcgtctcgcgctgtccggcgagcattgc
gaggatccgcacgtcgagcggatgatcgagtcgttcgcgctgctcggcgcgcgtatcaac
aagaagctcgacgacgattacccggaattcaccgaagcgctgctggaagtgctgtatccg
cactacctgcggccgttcccgtcgtgctcgatcgcgcagttcacgccggcgtcgcccggt
cagcagaccgaaccggtcgtgatcgatcgcggcaccgagctgaaaagccgcccgatccgc
ggcgtgcaatgccggttccgtaccgcctacgacgtgacgcttgcgccgatccgcatctcg
gaggcgcgctatacgccggtcgcgctcgcgccgagcgcgacggtgctgccgtcgaacgcg
acgggcgtgatctcgatcacgttcgaatcgctcgccgcgcagctcgatctcggcgcgctg
aagctgtcgacgctgcgcgcgcacctgcacggcgagcagtcgttcgtcgccgcgctgacc
gactgcctgttcgtcaacgtgctcggcgcgtacgtcgagcccgaacgcaacggccgctgg
accgcgctgcgcaagctgccgatcgcgcaggccggtttcgccgaggacgacgcgctgatc
gactatccggcgaaatcgcatcccgcgtaccggctgctcaccgaatacttcgcgttcccc
gacaagttcgatttcgtcgacttcgacctcgcggcgatcgcacgcgcgtcgggccgctgc
cagcgcgcgacgctgcatctggtgctgcaggacgtgcgcagcgattcgcatatcgcgcgc
ctgctcgagctgctgacggcgagccatttccggctgttctgcacgccgatcgtcaacctg
ttccgccagcacggggagccgatccgcatcacgcaccgcgcggtgtcgtatccggtgatt
gccgaggcgcggcgtgcgttcgcgtacgaggtgtactcgatcgactcggtgaagctcgtc
cggcagcaggcgcacgaggaatcggtgatcgagttccggccgttctattcgctgcatcac
ggcgaatcggcgcgcatcggccattactggttcgcgcgccgcaacgactgggtcgcgcag
aagagccccggctatgaaaccgagatctcgatcgtcgacatcgacttcgagccgacgtcg
ccgcagaccgacacgctgagcctcgacctcacctgcacgaaccgcgacctgccttcgatg
ctggcgttcggcctcgaaggcggcgacctgttccaggaaggcggggcgcagacgagcggc
atctcgctgctgcgccgcccgacgcagagcgtgcgcttcgagcgcggccgtgccgcgcac
tggcggctcgtgtcgcatctcgcgctcaaccacgtgtcgctcgttgcgcacggcctcgcg
ccgctgaaggaaatgctgacgctgtacgacctgcggcgcacggccgtgtcgatgcgccag
atcgacgggctggccggcgtcgagcagcgcggggcggtgcagtggctgcccggcaagccg
ttcgcgaccttcgtgcgcggcatcgagatccggctgacgatcgacgaagagcacttcgtc
ggcgcgagccttgcgtcgttcgtgcgcgtgctcgacagcttcttcgggctgtacgtccac
ctcaacagtttcgttcaattggtcgtcgtgtcgaagcgcaccggcgaggagatcatccga
tgcaagccccgaaccggcgaatcgatcctggcgtag

DBGET integrated database retrieval system