KEGG   Burkholderia cenocepacia HI2424: Bcen2424_0475
Entry
Bcen2424_0475     CDS       T00415                                 

Definition
(GenBank) Rhs element Vgr protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
bch03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bch00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Bcen2424_0475
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bch02044]
    Bcen2424_0475
Secretion system [BR:bch02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Bcen2424_0475
SSDB
Motif
Pfam: Phage_GPD DUF2345 T6SS_Vgr Phage_base_V DUF3540 Sarcoglycan_1
Other DBs
NCBI-ProteinID: ABK07229
Position
1:528742..531303
AA seq 853 aa
MNVTELAQAIRGGLIQQDRLLKTDIPSLPNNALVPRRAVTRSELGRDFSVTLDLVSTASD
VELKTLVAQPITLWIQQADRSYQPINGYIHTARRLGADGGLSSYQLRFASWMHFLKFRSD
MRYWQDQPVDAILADVFDRHPQARGQYRFALSKPLPSRSYCRQSETDWNFVHRLMEDEGL
FGFWRHSEDGKAHTFVITDDLHTVDALSPNTVRFDRSGSGAETAGFTQWTASRTLQSTLH
TTRTFDYKSPSSAGNPNGTSLPTKSGQGELPDQAEIYEYTGAYTYPAQDRGEHLSKIRLE
EWESRAKRFFGVGGVRSIDAGRRFTLVDHPEHDRDAASDREFAAIGVTRYIENNLPASDH
EASFPHSLQDALAQVKAGHGKGGAFEVGHDDGSAGFYLVEVEAQRASMPYRSPFEHRKPA
MQLETAVVVGPKGEEVYTDALNRIKVMFVWDRQSEGRETASCWMRVVQSDTGGGYGAVHI
PRVGEEVLIGYIGGDCDRPIVMHRVYNGAAKPQWHSDGLLSGFRSKEYAGSGHNEMVLDD
ATGQNRARLFSSSGNSLLHLGYLIEQNGNTRGAYLGSGFDLRTDAYGALRAGQGLYVTTH
PKQANSQPLDVTEAKQQLGSAEGLIESMSQVSEMHQAESLGTGRDALKQFADATQNSVAG
VASGGGRTAGGGTGNANAFKEPVMLFASPAGIGMASQQSVHLASEQHTNIVSGQSTFVTS
GKSLIAGIRDRISLFAQNAGMKLFAGKGKVEVQAHADNVELTAQKAVKMVAATEAVDVAA
KQEILLTSGGAYIRIKGGKIELHAPGKVDFKGAQHQFSGPTSMQYPLPAMPGGTCKQCVL
NAHSGRESMVEAD
NT seq 2562 nt   +upstreamnt  +downstreamnt
atgaacgtgaccgaactggcccaggcgattcgtggcggcctgatccagcaggatcggctg
ctgaagacggacatcccgtcgttgccgaacaatgcgctcgtgccgcgtcgcgccgtaacc
cgctcggagctcggccgtgatttcagcgtaacgctcgatctggtgtccaccgcgagcgac
gtcgagctcaagacgctggtcgcgcagccgatcacgctgtggattcagcaggcggacagg
tcgtatcagccgatcaacggctatatccacacggcgcggcggctcggtgccgacggcggc
ctgtcgagttaccagctgcgcttcgcgtcgtggatgcacttcctcaagttccgtagcgac
atgcggtactggcaggaccagccggtcgacgcgatcctcgccgacgtgttcgacaggcat
ccgcaggccaggggccaataccggttcgcgctgtcgaagccgctgccgtcccgttcgtac
tgccgccagagcgaaaccgactggaacttcgtgcatcggctgatggaggacgaagggctg
ttcggcttctggcggcacagtgaagacgggaaggcgcatacgttcgtcatcactgacgat
ctgcataccgtcgatgcgctgtcgccgaataccgtcaggttcgatcgctcgggcagcggc
gccgaaaccgccggtttcacgcaatggaccgcgtcgcggaccttgcaaagtacgctgcat
acgacgcgcacgttcgactacaagtcgccgtcgtcggcgggcaatccgaacggcacgtcg
ctgccgacgaaaagcgggcagggcgagctgcccgatcaggcggaaatttacgaatacacc
ggcgcttacacgtatccggcgcaggaccgcggcgaacacctgtcgaagattcgcctcgag
gaatgggagtcgcgtgcgaagcgtttcttcggcgtgggcggcgtgcgttcgatcgacgcc
ggccggcgtttcaccctcgtcgaccatccggagcacgatcgcgatgcggcgagcgaccgc
gagttcgcggccatcggcgtcacgcgttacatcgagaacaatctgccggcctctgaccac
gaagcaagtttcccgcatagcctgcaggacgcgctggcgcaggtgaaggccgggcacggg
aaagggggcgcgttcgaggtcgggcacgacgacggctcggccgggttctatctcgtcgag
gtcgaggcgcagcgcgcgagcatgccgtaccgcagcccgttcgagcaccgcaagcccgcg
atgcagctcgagacggccgtcgtggtcggtccgaagggcgaggaggtctataccgacgcg
ctgaaccggatcaaggtcatgttcgtgtgggaccggcagagcgaaggccgcgagacggca
tcgtgctggatgcgcgtcgtgcaatcggataccggcggcggttacggcgcggtgcatatt
ccgcgcgtcggcgaggaagtgctgatcggctacatcggcggcgactgcgatcggccgatc
gtcatgcatcgtgtctacaacggggcggccaagccgcaatggcatagcgacgggctcctg
tcgggcttccggtcgaaggagtatgcggggtcggggcacaacgagatggtgctcgacgac
gcgactgggcagaaccgcgcgcgcctgttcagcagcagcgggaattcgctgcttcatctc
ggctatctgatcgagcagaacggcaacacccgtggtgcgtatctcggctcgggtttcgat
ctgcgcacggatgcgtacggcgcgctgcgcgcgggccaagggctgtacgtgacgacgcat
ccgaagcaggcgaacagtcagccgctcgatgtgacggaggcgaagcagcagcttggcagt
gcagaagggttgatcgagtcgatgtcgcaggtgagcgagatgcatcaggccgagagcctc
ggtaccggtcgcgatgcgctgaagcagttcgccgatgcgacgcagaacagcgtggcgggg
gtggcctcggggggcggcaggacggccggcggcggaacggggaatgccaatgcgttcaag
gaacccgtgatgctgttcgcgagcccggcggggatcgggatggcgtcgcagcagtcggtg
catctggcgagcgagcagcacaccaatattgtcagcgggcaaagcacgttcgtgaccagt
gggaaatcgctgatcgccggcatccgggatcgcatcagcctgttcgcgcagaacgccggg
atgaagctgtttgccgggaagggcaaggtcgaggtccaggcgcacgcggacaacgtcgaa
ctcaccgcgcaaaaggccgtgaagatggtagcggcgaccgaggctgtcgacgtggctgcg
aagcaggagatattgctgacgtcgggtggcgcgtacatccggatcaagggcggcaaaatc
gagcttcacgcacccgggaaagtcgatttcaagggggcgcagcaccagttcagcggaccg
acgagcatgcagtatccattgcccgcgatgccgggcggcacgtgcaagcaatgcgtgctg
aacgcgcacagcggtcgtgagtcgatggtcgaggcggattga

DBGET integrated database retrieval system