KEGG   Burkholderia cenocepacia HI2424: Bcen2424_0584Help
Entry
Bcen2424_0584     CDS       T00415                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
bch00330  Arginine and proline metabolism
bch00332  Carbapenem biosynthesis
bch01100  Metabolic pathways
bch01130  Biosynthesis of antibiotics
bch01230  Biosynthesis of amino acids
Module
bch_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bch00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Bcen2424_0584
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Bcen2424_0584
Enzymes [BR:bch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Bcen2424_0584
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ABK07338
UniProt: A0K4B1
Position
1:655818..656936
Genome map
AA seq 372 aa AA seqDB search
MRSIIADSKRLVVKVGSSLVTNDGKGLDHAAIGRWAAQIAALRAQGKEVVLVSSGAIAEG
MQRLGWSKRPREIDELQAAAAVGQMGLAQVYESRFTEHGIRTAQILLTHADLADRERYLN
ARSTLLTLLRLGVVPIINENDTVVTDEIKFGDNDTLGALVANLIEGDALIILTDQSGLFT
ADPRKDPNATLVGEANAGAPELEAMAGGAGSSLGRGGMLTKILAAKRAAHSGANTVIASG
READVLVRLAAGEAIGTQLIARTARMAARKQWMADHLQVRGHVVIDAGAVEKLTAGGKSL
LPIGVIDVQGAFARGEVIACVGPDGREVARGLTNYSSAETKLIHRKPSGEIETVLGYMLE
PELIHRDNLVLV
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcgttcgatcatcgcggattcgaagcgattggtggtgaaagtgggctcgagcctcgtg
accaacgacggcaaggggctcgatcatgctgcaatcggccgctgggcagcccagatcgcg
gcactgcgtgcgcagggcaaggaagtcgtgctcgtcagttcgggggcgattgccgaaggc
atgcagcggctcggctggagcaagcggccgcgggaaatcgacgagctgcaggccgccgcc
gcggtcgggcagatggggctcgcgcaagtctacgagagccgcttcaccgagcacggcatc
cgcaccgcgcagatcctgctcacgcacgccgatctggcggatcgcgagcgctacctgaac
gcgcgttcgacgctgctcacgctgctgcggctcggcgtcgtgccgatcatcaacgagaac
gacacggtcgtcaccgacgaaatcaagttcggcgacaacgacacgctcggcgcgctcgtc
gcgaacctgatcgaaggcgatgcgctgatcatcctcaccgaccagtcggggctgttcacg
gccgatccgcgcaaggacccgaacgcgacgctcgtcggcgaggccaacgcgggcgcaccg
gagctcgaggcgatggcgggcggggccggttcgagtctcggtcgcggcgggatgctgacg
aagatcctcgcggcgaagcgcgcggcacacagcggcgcgaacaccgtgatcgcgagtggc
cgcgaggccgacgtgctcgtccgtctggcggctggcgaggcgatcggcacgcaactgatc
gcacgtaccgcgcggatggcggcacgcaagcaatggatggccgaccatctgcaggtgcgc
ggccacgtcgtgatcgatgcgggcgcggtcgagaagctcacggccggcggcaagagcctg
ctgccgatcggcgtgatcgacgtgcagggcgcgttcgcgcgcggcgaagtgatcgcctgc
gtcggcccggacgggcgcgaggtggcgcgcgggctcacgaactacagcagcgcggaaacg
aagctgattcaccgcaagccgagcggcgagatcgagaccgtgcttggctacatgctggag
cccgaactgattcatcgcgacaacctcgtgctggtgtaa

DBGET integrated database retrieval system