KEGG   Burkholderia cenocepacia HI2424: Bcen2424_0965Help
Entry
Bcen2424_0965     CDS       T00415                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
bch00010  Glycolysis / Gluconeogenesis
bch00052  Galactose metabolism
bch00500  Starch and sucrose metabolism
bch00520  Amino sugar and nucleotide sugar metabolism
bch00521  Streptomycin biosynthesis
bch01100  Metabolic pathways
bch01110  Biosynthesis of secondary metabolites
bch01120  Microbial metabolism in diverse environments
bch01130  Biosynthesis of antibiotics
bch01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bch00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcen2424_0965
   00052 Galactose metabolism
    Bcen2424_0965
   00500 Starch and sucrose metabolism
    Bcen2424_0965
   00520 Amino sugar and nucleotide sugar metabolism
    Bcen2424_0965
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Bcen2424_0965
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Bcen2424_0965
Enzymes [BR:bch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Bcen2424_0965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase HTH_6 SIS SIS_2 ROK HTH_IclR LacI
Motif
Other DBs
NCBI-ProteinID: ABK07718
Position
1:complement(1071245..1073173)
Genome map
AA seq 642 aa AA seqDB search
MSTGAQSKAVVAGQHADGPRLLADVGGTNARFALETGPGEITQIRVYPGADYPTITDAIR
KYLKDVKISRVNHAAIAIANPVDGDQVTMTNHDWSFSIEATRRALGFDTLLVVNDFTALA
MALPGLTDAQRVQVGGGARRQNSVIGLLGPGTGLGVSGLIPADDRWIALGSEGGHASFAP
QDEREDLVLQYARKKFPHVSFERVCAGPGMEIIYRALAARDKKRVAATVDTVEIVERAHA
GDALALETVECFCGILGAFAGSVALTLGALGGVYIGGGVALKLGELFTRSSFRARFEAKG
RFTHYLENIPTYLITAEYPAFLGVSAILAEQLSNRSGGASSAVFERIRQMRDALTPAERR
VADLALNHPRSIINDPIVDIARKADVSQPTVIRFCRSLGCQGLSDFKLKLATGLTGTIPM
SHSQVHLGDTATDFGAKVLDNTVSAILQLREHLNFEHVENAIEILNGARRIEFYGLGNSN
IVAQDAHYKFFRFGIPTIAYGDLYMQAASAALLGKGDVIVAVSKSGRAPELLRVLDVAMQ
AGAKVIAITSSNTPLAKRATVALETDHIEMRESQLSMISRILHLLMIDILAVGVAIRRAS
TNGELPEAVAQAKARASDDETADVLDWLSHGASPAAKDVARD
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgtctactggtgcgcaaagtaaggcggtcgtcgcgggtcagcatgccgacggcccgcgc
ctgctcgcggacgtcggcggcaccaacgcgcgcttcgcgctggaaaccggccccggcgag
atcacgcagatccgcgtgtatcccggcgccgactatccgacgatcaccgacgcgatccgc
aagtatctgaaggatgtgaagatcagccgcgtgaaccacgcggcgatcgcgatcgcgaac
ccggtcgacggcgaccaggtcacgatgaccaaccacgactggagtttctcgatcgaggcg
acgcgccgcgcgctcggcttcgacacgctgctggtcgtcaacgacttcaccgcgctcgcg
atggcgctgccgggcctgaccgatgcccagcgcgtgcaggtcggcggcggcgcacgtcgc
cagaacagcgtgatcggcctgctcgggcccggtaccgggctcggcgtgtcggggctgatt
ccggccgatgaccgctggatcgcgctcggcagcgaaggcggccacgcatcgttcgcgccg
caggacgagcgcgaggacctggtactgcagtacgcgcgcaagaagtttccgcacgtgtcg
ttcgaacgcgtgtgcgcgggccccggcatggagatcatctatcgcgcgctcgcggcgcgc
gacaagaagcgcgtcgccgcgaccgtcgacacggtcgagatcgtcgagcgcgcgcatgcg
ggcgacgcgctcgcgctcgagacggtcgaatgcttctgcgggattctcggcgcgttcgcg
ggcagcgtcgcgctaacgctcggcgcgctaggcggcgtgtacatcggcggtggcgtcgcg
ctgaagctgggcgagctgttcacgcgctcgtcgttccgcgcgcgcttcgaggcgaagggc
cgcttcacgcactacctcgaaaacatcccgacctacctgatcaccgccgaatatccggcg
ttcctcggcgtatcggcgatcctcgcggagcagttgtcgaaccgttcgggcggcgcgtcg
tcggccgtgttcgagcgaatccgccagatgcgcgacgcactgacgccggccgagcgccgc
gtcgccgatctcgcgctgaaccatccgcgctcgatcatcaacgatccgatcgtcgacatc
gcgcgcaaggccgacgtgagccagccgaccgtgatccgcttctgccgctcgctcggctgc
caggggctgtcggacttcaagctgaagctcgccaccggcctcaccggcacgatcccgatg
agccacagccaggtgcatctcggcgatacggccaccgacttcggcgcgaaggtgctcgac
aacacggtgtccgcgatcctgcagctgcgcgagcacctgaatttcgagcacgtcgagaac
gcgatcgagatcctgaacggcgcgcgccgcatcgagttctacgggctcggcaactcgaac
atcgtcgcgcaggacgcgcactacaagttcttccgcttcggcattccgacgatcgcgtac
ggcgacctgtacatgcaggccgcgtcggccgcgctgctcggcaagggcgacgtgatcgtc
gcggtgtcgaagtcgggccgcgcgcccgagctgctgcgcgtgctcgacgtcgcgatgcag
gccggcgcgaaggtgatcgcgatcacgtcgagcaacacgccgctcgcgaagcgcgcgacc
gtcgcgctcgaaaccgaccacatcgagatgcgcgagtcgcagttgtcgatgatctcgcga
attctgcatctgctgatgatcgacatcctcgcggtcggcgtcgcgatccgtcgcgcgtcg
acgaacggcgaactgcccgaagccgtcgcgcaggcgaaagcgcgcgccagcgacgacgaa
acggccgacgtgctcgactggctgagccacggcgcgtcgccggcggcgaaggacgtcgcg
cgggactag

DBGET integrated database retrieval system