KEGG   Burkholderia cenocepacia HI2424: Bcen2424_1837Help
Entry
Bcen2424_1837     CDS       T00415                                 

Definition
(GenBank) alpha/beta hydrolase fold protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
bch00010  Glycolysis / Gluconeogenesis
bch00020  Citrate cycle (TCA cycle)
bch00620  Pyruvate metabolism
bch01100  Metabolic pathways
bch01110  Biosynthesis of secondary metabolites
bch01120  Microbial metabolism in diverse environments
bch01130  Biosynthesis of antibiotics
bch01200  Carbon metabolism
Module
bch_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bch00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcen2424_1837
   00020 Citrate cycle (TCA cycle)
    Bcen2424_1837
   00620 Pyruvate metabolism
    Bcen2424_1837
Enzymes [BR:bch01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Bcen2424_1837
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_6 Abhydrolase_1 Hydrolase_4 Biotin_lipoyl Thioesterase Abhydrolase_5 PGAP1 Ndr Esterase Ser_hydrolase DUF915 DUF900 Abhydrolase_3 FSH1 LIDHydrolase Lipase_3 DUF676
Motif
Other DBs
NCBI-ProteinID: ABK08588
Position
1:complement(2040935..2042050)
Genome map
AA seq 371 aa AA seqDB search
MSIHMITMPKWGLSMEQGQVNGWLKAVGERVAKGDEVLDVETDKISSGVECAFDGTLRRQ
VAQEGETLPVGALLGVVAAAEASDADIDAAIADFQRDFVPSAASDEAAGPQPEKAQIGGR
TVRFLKLGEGSGTPAVLIHGFGGDLNNWLFNHAELAAHRPVWALDLPGHGESGKAVETGS
LDELADAVLALLDAQHIERAHLIGHSMGGAVAMTVAERAPQRVASLTLIASAGLGTDINR
AYIDGFVAGNSRNTLKPHLGALFADDALVTRQLVEDLVKYKRLEGVQAALEKIAHAAFDG
AAQRRVFRDRLATLAPRTLVIWGERDQVIPAQHAQGLPDGVRAEVIAGSGHMVQMEAAAD
VNRLIVAFLGD
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattcacatgatcacgatgcccaaatgggggctgtcgatggagcaggggcaggtc
aacggctggctgaaggcggtcggcgaacgcgtggcgaagggcgacgaagtgctcgacgtc
gagaccgacaagatctcgtcgggtgtcgaatgcgcattcgacggcacgctgcgccggcag
gtcgcgcaggagggcgagacgctgcccgtcggcgcgctgctcggtgtcgtcgcggccgcc
gaggcgagcgatgccgacatcgacgcggcgatcgccgatttccagcgcgatttcgtgccg
agcgcggcgtccgacgaggcggccggcccgcagccggagaaggcgcagatcggcggccgc
acggtccgcttcctgaagctgggcgaggggtcgggcacgcccgccgtgctgatccacggc
ttcggcggcgacctgaacaactggctgttcaaccacgcggagctcgccgcgcaccggccg
gtgtgggcgctcgatctgcccggccacggcgaatcgggcaaggcggtcgagaccggcagc
ctcgacgaactggccgacgcggtgctcgcgctgctcgatgcgcagcacatcgagcgcgcg
cacctgatcggccattcgatgggcggggcggtcgcgatgacggtggccgagcgcgcaccg
caacgcgttgcatcgctcacgctgatcgcgagcgcggggctcggcaccgacatcaaccgc
gcgtacatcgacggcttcgtcgccggcaacagccgcaacacgctgaaaccgcacctcggc
gcgctgttcgcggacgacgcgctggtcacgcggcaactcgtcgaggacctcgtcaagtac
aagcggctcgaaggcgtgcaggccgcgctggagaagatcgcgcacgccgcgttcgacggc
gccgcgcagcggcgtgtgttccgtgaccggctcgcgacgctggcgccgcgcacgctcgtg
atctggggcgagcgcgaccaggtgattcccgcgcagcatgcgcagggcttgccggacggc
gtgcgtgccgaggtgatcgccggcagcgggcacatggtgcagatggaagcggccgccgac
gtgaaccgcctgatcgtcgcgttcctcggagactga

DBGET integrated database retrieval system