KEGG   Burkholderia cenocepacia HI2424: Bcen2424_2048Help
Entry
Bcen2424_2048     CDS       T00415                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
bch00630  Glyoxylate and dicarboxylate metabolism
bch01100  Metabolic pathways
bch01110  Biosynthesis of secondary metabolites
bch01120  Microbial metabolism in diverse environments
bch01200  Carbon metabolism
Module
bch_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bch00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Bcen2424_2048
Enzymes [BR:bch01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Bcen2424_2048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABK08799
Position
1:2272604..2273911
Genome map
AA seq 435 aa AA seqDB search
MSRQQQAQELQQQWETDPRWKGIKRSYLAEDVVRLRGSIPIEHTLAKRGAEKLWGLINNE
PFVNALGALTGNQAMQQVKAGLKAIYLSGWQVAGDANVAGEMYPDQSLYPANSVPLVVKR
INNTLTRADQIQWSEGKNPGDEGYVDFFAPIVADAEAGFGGVLNAFELMKAMIEAGASGV
HFEDQLASVKKCGHMGGKVLVPTREAVAKLSAARLAADVMGTPTVLVARTDAEAADLITS
DVDDNDKPFLTGERTVEGFFRTKPGLEQAVSRGLAYAPYADLIWCETGKPDLEYAKKFAE
AIHKQFPGKLLSYNCSPSFNWKKNLDDATIAKFQKELGAMGYKFQFITLAGFHALNYSMF
NLAHGYARTQMSAFVELQQAEFAAADKGFTAVKHQREVGTGYFDAVTQTVEREASTTALH
GSTEDEQFFDGKKVA
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgtcagcaacaggcacaggaactgcagcagcaatgggaaaccgatccgcgctgg
aagggcatcaagcgcagctacttggctgaggacgtggtccgcctgcgcggctcgatcccg
atcgagcacacgctggccaagcgcggcgcggaaaaactgtggggcctcatcaacaacgag
ccgttcgtcaacgcactcggcgcgctgaccggcaatcaggcgatgcagcaggtgaaggcc
ggcctgaaggccatctacctgtccggctggcaagtcgccggcgacgcgaacgtcgcgggc
gaaatgtacccggaccagtcgctgtacccggccaactcggtgccgctcgtcgtgaagcgc
atcaacaacacgctgacgcgcgccgaccagatccagtggtcggaaggcaagaacccgggc
gacgaaggttacgtcgacttcttcgcgccgatcgtcgccgatgcggaagccggtttcggc
ggcgtgctcaatgcgttcgagctgatgaaggcgatgatcgaggccggcgcatcgggcgtt
cacttcgaggaccagctcgcatcggtgaagaagtgcggccacatgggcggcaaggtgctc
gtgccgacgcgcgaagccgtcgcgaaactgtcggccgcgcggctcgcggccgacgtgatg
ggcacgccgaccgtgctggttgcgcgcaccgacgcggaagcggccgacctgatcacgtcc
gacgtcgacgacaacgacaagccgttcctgaccggcgagcgcacggtggaaggcttcttc
cgcacgaagccgggcctcgaacaggcggtctcgcgcggcctcgcgtacgcgccgtacgcc
gacctgatctggtgcgaaaccggcaagcccgatctcgagtacgcgaagaagttcgcggaa
gcgatccacaagcagttcccgggcaagctgctgtcgtacaactgctcgccgtcgttcaac
tggaagaagaacctcgacgacgcgacgatcgcgaagttccagaaggagctgggcgcgatg
ggctacaagttccagttcatcacgctggccggcttccatgcgctgaattactcgatgttc
aacctcgcgcacggctatgcccgcacgcagatgagcgcgttcgtcgaactgcagcaggcc
gagttcgcggccgccgacaagggcttcacggcagtcaagcatcagcgcgaggtcggcacc
ggctacttcgacgcggtgacgcagacagtcgaacgcgaagcatcgacgaccgcgctgcac
ggctcgaccgaggacgaacagttcttcgacggcaagaaagtcgcgtaa

DBGET integrated database retrieval system