KEGG   Burkholderia cenocepacia HI2424: Bcen2424_2107Help
Entry
Bcen2424_2107     CDS       T00415                                 

Definition
(GenBank) enolase
  KO
K01689  enolase [EC:4.2.1.11]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
bch00010  Glycolysis / Gluconeogenesis
bch00680  Methane metabolism
bch01100  Metabolic pathways
bch01110  Biosynthesis of secondary metabolites
bch01120  Microbial metabolism in diverse environments
bch01130  Biosynthesis of antibiotics
bch01200  Carbon metabolism
bch01230  Biosynthesis of amino acids
bch03018  RNA degradation
Module
bch_M00002  Glycolysis, core module involving three-carbon compounds
bch_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcen2424_2107
  09102 Energy metabolism
   00680 Methane metabolism
    Bcen2424_2107
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    Bcen2424_2107
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bch03019]
    Bcen2424_2107
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bch04147]
    Bcen2424_2107
Enzymes [BR:bch01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     Bcen2424_2107
Messenger RNA biogenesis [BR:bch03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Bcen2424_2107
Exosome [BR:bch04147]
 Exosomal proteins
  Proteins found in most exosomes
   Bcen2424_2107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Enolase_C Enolase_N MAAL_C MR_MLE_C
Motif
Other DBs
NCBI-ProteinID: ABK08858
UniProt: A0K8N1
Position
1:complement(2336617..2337900)
Genome map
AA seq 427 aa AA seqDB search
MSAIVDIIGREILDSRGNPTVECDVLLESGTMGRAAVPSGASTGSREAIELRDGEAGRYN
GKGVLKAVEHINTEISEAIMGLDASEQAFLDKTLLELDGTDNKSRLGANAMLAVSMAVAK
AAAEEAGLPLYRYFGGSGAMQLPVPMMNIVNGGAHANNSLDIQEFMIVPVSQPTFREALR
CGAEVFHALKKILSDRGMSTAVGDEGGFAPNFGSNDECLSTILQAIEKAGYRAGEDVLLA
LDCAASEFYHDGKYQLAGEGLQLSSAEFTDYLATLADKFPIVSIEDGMHESDWDGWKLLT
DRLGKKVQLVGDDLFVTNTRILKEGIEKGIANSILIKINQIGTLTETFAAIEMAKRAGYT
AVISHRSGETEDSTIADIAVGLNAGQIKTGSLSRSDRISKYNQLLRIEEDLGDIASYPGK
SAFYNLR
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcaatcgtagatatcatcggccgcgagattctggattcgcgcggcaaccccacc
gtcgaatgcgacgtgctgctcgaatcgggcacgatgggccgcgcggcggtgccgtcgggc
gcgtccaccggctcgcgtgaagcgatcgaactgcgcgacggcgaagccggccgctacaac
ggcaagggcgtgctgaaggcagtcgagcacatcaacaccgaaatctccgaagccatcatg
ggcctcgacgcgtcggaacaggcgttcctcgacaagacgctgctcgagctggacggcacc
gacaacaagtcgcgcctgggcgcgaacgcgatgctggccgtgtcgatggccgtcgcgaag
gccgccgccgaagaggccggcctgccgctgtaccgctacttcggcgggtcgggtgcgatg
caactgccggtgccgatgatgaacatcgtcaacggcggcgcgcacgcgaacaacagcctg
gacatccaggaattcatgatcgttccggtcagccagccgacgttccgtgaagcgctgcgt
tgcggcgcggaagtgttccacgcgctgaagaagatcctgagcgaccgcggcatgagcacg
gccgtcggcgacgaaggcggtttcgcgccgaacttcggcagcaacgacgagtgcctgtcg
acgatcctgcaggcgatcgagaaggccggctaccgtgcgggcgaagacgtgctgctcgcg
ctcgactgcgcggcatccgagttctaccacgacggcaagtaccagctcgccggcgaaggc
ctgcaactgtcgtcggccgaattcaccgactacctcgcgacgctcgccgacaagttcccg
atcgtgtcgatcgaggacggcatgcacgaaagcgactgggacggctggaagctgctgacc
gatcgcctcggcaagaaggtgcagctggtcggcgacgacctgttcgtcacgaacacgcgc
atcctgaaggaaggcatcgagaagggcatcgcgaactcgatcctcatcaagatcaaccag
atcggtacgctgaccgaaacgttcgcggcgatcgaaatggcgaagcgcgcgggctacacg
gccgtgatctcgcaccgctcgggcgaaacggaagattcgacgatcgcggacatcgcggtc
ggcctgaacgccggtcagatcaagacgggttcgctgtcgcgcagcgaccgcatttcgaag
tacaaccagctgctgcgcatcgaggaagatctcggcgacatcgcgagctacccgggcaaa
tcggctttctataacctgcgctaa

DBGET integrated database retrieval system