KEGG   Burkholderia cenocepacia HI2424: Bcen2424_2191Help
Entry
Bcen2424_2191     CDS       T00415                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
bch00010  Glycolysis / Gluconeogenesis
bch00620  Pyruvate metabolism
bch00640  Propanoate metabolism
bch00680  Methane metabolism
bch01100  Metabolic pathways
bch01110  Biosynthesis of secondary metabolites
bch01120  Microbial metabolism in diverse environments
bch01130  Biosynthesis of antibiotics
bch01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bch00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcen2424_2191
   00620 Pyruvate metabolism
    Bcen2424_2191
   00640 Propanoate metabolism
    Bcen2424_2191
  Energy metabolism
   00680 Methane metabolism
    Bcen2424_2191
Enzymes [BR:bch01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Bcen2424_2191
Lipid biosynthesis proteins [BR:bch01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Bcen2424_2191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABK08942
Position
1:complement(2442112..2444094)
Genome map
AA seq 660 aa AA seqDB search
MSAIESVLHETRQFAPPAALEKTATISGMPAYRALVAEAEQDYEGFWARLAREGLTWHKP
FTKVLDERNAPFYTWFDDGELNASYNCLDRHVEAGNGERVAVIFEADDGTVTRVTYADLL
ARVSRFANALKKRGIGKGDRVVIYIPMSIEGIVAMQACARIGATHSVVFGGFSAKSLNER
LVDVGAVALITADEQARGGKTLPLKSIADEAIALGGCEAVKSVIVYRRTGGKIDWHAERD
LWMHELTDGESDQCEPTWVGAEHPLFILYTSGSTGKPKGVQHSTGGYLLWAAQTMKWTFD
WKPDDVFWCTADIGWVTGHTYITYGPLACGGTQVVFEGVPTYPDAGRFWKMIGDHKVTVF
YTAPTAIRSLIKAAEADDKVHPKSYDLSSLRIIGTVGEPINPEAWMWYHKHVGHERCPIV
DTWWQTETGGHMITPLPGATPTVPGSCTLPLPGITAAVVDETGQDVPNGQGGILVVKRPW
PAMIRTIWGDPERFKKSYYPEELGGTLYLAGDGTVRDKETGYFTIMGRIDDVLNVSGHRL
GTMEIESALVSHELVAEAAVVGRPDDTTGEAVVAFVVLKRSRPEGEEAAALAKTLRDWVG
KQIGPIAKPKDIRFGDNLPKTRSGKIMRRLLRSLAKGEAITQDTSTLENPAILEQLTEVR
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcgattgaatcggttcttcacgaaacccgtcagttcgcgccgcccgcggcgctc
gagaagacggcgaccatttccggcatgccggcctaccgcgcgctcgtcgccgaggccgag
caggattacgaaggcttctgggcgcgcctcgcgcgcgaaggcctcacgtggcacaagccg
ttcaccaaggtgctcgacgagcgcaacgcgccgttctacacatggttcgacgacggcgag
ctgaacgcgtcgtacaactgcctcgaccgccacgtcgaagccggcaacggcgagcgcgtc
gcggtgatcttcgaggccgacgacggcaccgtcacccgcgtcacctatgcggacctgctc
gcacgcgtgtcgcgtttcgccaatgcgctgaagaaacgcggcatcggcaagggcgatcgc
gtcgtcatctacattccgatgtcgatcgaaggcatcgtcgcgatgcaggcctgcgcgcgc
atcggcgcgacgcactcggtcgtgttcggcggcttctccgcgaaatcgctgaacgagcgg
ctcgtcgacgtcggcgcggtcgcgctgatcaccgccgacgagcaggcgcgcggcggcaag
acgctgccgctcaagagcatcgccgacgaagcgatcgcgctgggcggctgcgaagcggtc
aagagcgtgatcgtctatcgccgcaccggcggcaagatcgactggcatgcggagcgcgac
ctctggatgcatgagctgaccgacggcgaatccgaccaatgcgagccgacctgggtcggc
gccgagcatccgctgttcatcctgtatacgtcgggctcgaccggcaagccgaagggcgtg
cagcacagcacgggcggctacctgctgtgggccgcgcagacgatgaagtggaccttcgac
tggaaacccgacgacgtgttctggtgcacggccgacatcggctgggtcacgggccacacg
tacatcacctacggcccgctcgcgtgcggcggcactcaggtcgtgttcgaaggcgtgccg
acgtatccggacgccggccgcttctggaagatgatcggcgatcacaaggtcaccgtgttc
tacaccgcaccgaccgcgatccgttcgctgatcaaggcggccgaagcggacgacaaggtc
catccgaagagctatgacctgtcgagcctgcgcatcatcggcacggtcggcgagccgatc
aatccggaagcgtggatgtggtaccacaagcacgtcggccacgagcgctgcccgatcgtc
gacacgtggtggcagaccgaaaccggcggccacatgatcacgccgctgccgggcgcgacg
ccgaccgtaccgggctcgtgcacgctgccgctgccgggcatcacggccgcggtggtcgac
gagacgggtcaggacgtgccgaacgggcaaggcggcattctggtcgtcaagcgcccgtgg
ccggcgatgatccgcacgatctggggcgacccggagcgcttcaagaagagttactacccg
gaagaactcggcggcacgctctatctggccggcgacggcaccgtgcgcgacaaggagacc
ggctacttcacgatcatgggccggatcgacgacgtgctgaacgtgtcgggccaccggctg
ggcacgatggagatcgaatcggcgctggtgtcgcatgagctggtggccgaggcggcggtg
gtcggccgtccggacgacacgaccggtgaagcggtcgtggcgttcgtcgtgctgaagcgc
tcgcgtccggaaggcgaagaagcggcggcgctcgcgaagacgctgcgcgactgggtgggc
aagcagatcgggccgatcgcgaagccgaaggacatccgtttcggcgacaacctgccgaag
acccgctcgggcaagatcatgcggcgcctgctgcgctcgctcgcgaagggcgaggcgatc
acgcaggatacgtccacgctcgagaatccggccatcctcgagcagctcaccgaagtgcgc
tga

DBGET integrated database retrieval system