KEGG   Burkholderia cenocepacia HI2424: Bcen2424_2649Help
Entry
Bcen2424_2649     CDS       T00415                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
bch00020  Citrate cycle (TCA cycle)
bch00640  Propanoate metabolism
bch00660  C5-Branched dibasic acid metabolism
bch01100  Metabolic pathways
bch01110  Biosynthesis of secondary metabolites
bch01120  Microbial metabolism in diverse environments
bch01130  Biosynthesis of antibiotics
bch01200  Carbon metabolism
Module
bch_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bch_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bch00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bcen2424_2649
   00640 Propanoate metabolism
    Bcen2424_2649
   00660 C5-Branched dibasic acid metabolism
    Bcen2424_2649
Enzymes [BR:bch01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Bcen2424_2649
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A ATP-grasp K-cyclin_vir_C Dockerin_1
Motif
Other DBs
NCBI-ProteinID: ABK09399
UniProt: A0KA72
Position
1:complement(2935171..2936337)
Genome map
AA seq 388 aa AA seqDB search
MKIHEYQGKEILRKFGVAVPRGKPAFSVDEAVKVAEELGGPVWVVKAQIHAGGRGKGGGV
KVAKSIEQVREYANQILGMQLVTHQTGPEGQKVNRLMIEEGADIKQELYVSLVVDRISQK
IVLMGSSEGGMDIEEVAEKHPELIHKVIVEPSTGLLDAQADDLAAKIGVPAASIPQARAI
LQGLYKAFWETDASLAEINPLNVSGDGKVTALDAKFNFDSNALFRHPEIVAYRDLDEEDP
AEIEASKFDLAYISLDGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDVGGGATTEKVTE
AFKLMLKNPDLKAILVNIFGGIMRCDVIAEGVIAGSKAVNLNVPLVVRMKGTNEDLGKKM
LADSGLPIISADSMEEAAQKVVAAAAGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcacgagtaccagggtaaggaaatcctgcggaaattcggagtcgcggtaccg
cgcggcaagccggcgttctcggttgacgaggccgtcaaggtggcggaagagctcggcggc
ccggtatgggtcgtgaaggctcagattcacgcgggtggccgtggcaagggcggcggcgtg
aaggtggcgaagtcgatcgagcaggtccgcgaatacgcgaaccagatcctcggcatgcag
ctcgtcacgcaccagaccggtccggaaggccagaaggtcaaccgtctgatgatcgaggaa
ggcgccgacatcaagcaggaactgtatgtcagcctcgtcgtcgaccgcatctcgcagaag
atcgtgctgatgggctcgagcgaaggcggcatggacatcgaagaagtcgccgagaagcac
ccggaactgatccacaaggtcatcgtcgagccgtcgacgggcctgctggacgcgcaggcc
gacgacctcgccgcgaagatcggcgtgccggctgcgtcgattccgcaagcgcgcgcgatc
ctgcaaggcctgtacaaggcattctgggaaaccgacgcatcgctggccgaaatcaacccg
ctgaacgtctccggcgacggcaaggtcaccgcactcgacgcgaagttcaacttcgactcg
aacgcgctgttccgtcacccggaaatcgtcgcgtaccgcgatctggacgaagaagatccg
gctgaaatcgaagcgtcgaagttcgacctcgcgtacatctcgctcgacggcaacatcggc
tgtctcgtgaacggcgcgggcctcgcgatggcgacgatggacacgatcaagctgttcggc
ggcgaaccggcgaacttcctggacgtcggcggaggcgcgacgaccgagaaggtcacggaa
gcgttcaagctgatgctgaagaacccggacctgaaggcgatcctcgtgaacatcttcggc
ggcatcatgcgctgcgacgtgatcgcggaaggcgtgatcgccggttcgaaggccgtgaac
ctgaacgtgccgctggtcgtgcgcatgaagggcacgaacgaggacctcggcaagaagatg
ctggccgattcgggcctgccgatcatctcggcggacagcatggaagaggctgcgcagaag
gtcgtcgcggctgccgcaggcaagtaa

DBGET integrated database retrieval system