KEGG   Burkholderia cenocepacia HI2424: Bcen2424_2807
Entry
Bcen2424_2807     CDS       T00415                                 

Definition
(GenBank) pantetheine-phosphate adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
bch00770  Pantothenate and CoA biosynthesis
bch01100  Metabolic pathways
Module
bch_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:bch00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Bcen2424_2807
Enzymes [BR:bch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     Bcen2424_2807
SSDB
Motif
Pfam: CTP_transf_like ATP-sulfurylase Citrate_ly_lig
Other DBs
NCBI-ProteinID: ABK09557
UniProt: A0KAN0
Position
1:complement(3102948..3103445)
AA seq 165 aa
MVVAVYPGTFDPLTRGHEDLVRRASSIFDTLVVGVADSRAKKPFFSLEERLTIANEVLGH
YPNVKVMSFTGLLKDFVRVNNARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVETMFMTPS
DQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLTEKVTAMGGPAA
NT seq 498 nt   +upstreamnt  +downstreamnt
atggtagtcgccgtgtatcccggtacgttcgatccgctgacgcgcgggcacgaagacctc
gtgcggcgtgcgtcgagcatttttgatacgctggtggtgggcgttgccgacagccgcgcg
aaaaagccgtttttctcgctcgaggaacgtctgacgattgcgaacgaggtgctcggccat
tacccgaacgtgaaggtgatgagtttcaccggcctcctgaaggatttcgtccgcgtcaac
aatgcgcgcgtgatcgtgcgcgggttgcgcgccgtgtccgatttcgaatatgagttccag
atggcggggatgaaccgctatctgctgcccgacgtcgagacgatgttcatgacgccgtcc
gaccagtaccagttcatctcggggacgatcgtgcgcgaaatcgcgcagttgggcggcgat
gtcagcaaattcgtgtttccgtccgtcgagaagtggctgaccgagaaagtcaccgcgatg
ggaggcccggccgcgtga

DBGET integrated database retrieval system