KEGG   Burkholderia cenocepacia HI2424: Bcen2424_2958Help
Entry
Bcen2424_2958     CDS       T00415                                 

Definition
(GenBank) D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding protein
  KO
K12972  glyoxylate/hydroxypyruvate reductase [EC:1.1.1.79 1.1.1.81]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
bch00260  Glycine, serine and threonine metabolism
bch00620  Pyruvate metabolism
bch00630  Glyoxylate and dicarboxylate metabolism
bch01100  Metabolic pathways
bch01110  Biosynthesis of secondary metabolites
bch01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bcen2424_2958
   00630 Glyoxylate and dicarboxylate metabolism
    Bcen2424_2958
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bcen2424_2958
Enzymes [BR:bch01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     Bcen2424_2958
    1.1.1.81  hydroxypyruvate reductase
     Bcen2424_2958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C NAD_binding_2 3HCDH_N NAD_Gly3P_dh_N EAL F420_oxidored ThiF
Motif
Other DBs
NCBI-ProteinID: ABK09706
Position
1:3271322..3272263
Genome map
AA seq 313 aa AA seqDB search
MKILFHSPHQDAGAWRDEIARALPEAELRAWQPGDTAAADYALVWRPPRELFAPRDGLRA
IFNLGAGVDALLALEHAHPGTLPAHVPLVRLEDSGMAQQMVEYVTHAALRYLRRFDEYDL
QQRERRWQPLEPHARASFTVAVLGLGVLGAAVARALAALGLPVRGYSRSAKQLDGIATFA
GDGAFDACIDGAKVLVNLLPSTRDTDGILSARAFARLAPGAYVVNVARGAHLVEADLLDA
LASGQIAAATLDVFQHEPLPDDHPFWRAPRITITPHSSAETLRAEAVEQIAGKIRAFERG
ATVSGIVDYARGY
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcctgttccattcaccgcatcaggacgccggcgcatggcgcgacgagatcgcg
cgtgcactgccggaagccgaactgcgcgcctggcagccgggcgatacggccgccgccgac
tacgcgctcgtgtggcgcccgccgcgcgagttgttcgcgccgcgcgacggcctgcgcgcg
atcttcaacctcggcgcgggcgtcgatgcgctgctcgcgctcgagcacgcgcatccgggc
acgctgcccgcgcacgtgccgctggtgcggctcgaagattccggcatggcgcagcagatg
gtcgaatacgtgacgcacgcggcgctgcgctacctgcgccgtttcgacgaatacgacctg
caacagcgcgaacgccgctggcagccgctcgaaccgcatgcgcgcgcaagcttcaccgtc
gccgtcctcggcctcggcgtgcttggtgcggcagtcgcccgcgcgctcgccgcgctcggc
ctgccggtgcgcggctacagccgcagcgcgaagcagctcgacggcatcgcgaccttcgcc
ggcgacggcgcgttcgacgcgtgcatcgacggcgcgaaggtgctcgtcaacctgctgccg
agcacgcgcgacaccgacggcatcctgtcggcgcgcgcgttcgcgcggctcgcgcccggt
gcatacgtcgtcaacgtcgcgcgcggcgcgcatctcgtcgaagccgacctgctcgacgca
ctcgcgagcggccagatcgccgcggccacgctcgacgtgttccagcacgaaccgctgccg
gacgaccatccgttctggcgcgcgccgcgcatcacgatcacgccgcacagctcggccgag
acgctgcgcgcggaagccgtcgagcagatcgccggcaagatccgcgcgttcgagcgcggc
gcgaccgtcagcggcatcgtcgactacgcacgcggctactga

DBGET integrated database retrieval system