KEGG   Burkholderia cenocepacia HI2424: Bcen2424_3168Help
Entry
Bcen2424_3168     CDS       T00415                                 

Definition
(GenBank) malate--quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
bch00020  Citrate cycle (TCA cycle)
bch00620  Pyruvate metabolism
bch01100  Metabolic pathways
bch01110  Biosynthesis of secondary metabolites
bch01120  Microbial metabolism in diverse environments
bch01130  Biosynthesis of antibiotics
bch01200  Carbon metabolism
Module
bch_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bch_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bcen2424_3168
   00620 Pyruvate metabolism
    Bcen2424_3168
Enzymes [BR:bch01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     Bcen2424_3168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO
Motif
Other DBs
NCBI-ProteinID: ABK09915
UniProt: A0AWY9
Position
2:complement(717..2360)
Genome map
AA seq 547 aa AA seqDB search
MIKTLRVILSALALCVATSSAHAADTKKVDVLLVGGGIMSSTLGVWLHELQPNWSMTMVE
RLDGVALESSNGWNNAGTGHSALAELNYTPEKADGKVDISKAIEINESFQISRQFWAWQV
KQGVLKNPHSFINSTPHMSFVWGDDNVRFLKKRYEALQASPLFRGMQYSEDYDQIKQWVP
LMMEGRDRNQKVAATWTPIGTDVNFGEITRQFVGYLKTQPNFTLSLSSEVREITRNADGT
WHVSWVKLHSDEPPQSVDAKFVFIGAGGGALHLLQASGIPEAKDYGAFPVGGSFLVTDNP
EVVKQHLAKAYGKASVGSPPMSVPHLDTRIIDGKKIILFGPFATFSTKFLKNGSYFDLAK
STNLHNVAPMMRVGVDEFPLVQYLAGQLMLTDDDRFNALKEYFPNAKKEDWRLWQAGQRV
QIIKRDPVKGGVLKLGTEIVASQDGSIAGLLGASPGASTAAPIMLNLMQKVFKDKVATPE
WQQKIRQIVPSYGTKLNDSPAKVVEEWTYTSDVLQLSPPPKIDLGAPSQATGNAPARPAK
ASADMAL
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
gtgatcaaaacgttacgggtaatactgtcggcgctcgcgctgtgcgtcgcgacatcgtcg
gcgcacgccgccgatacgaagaaagtcgatgtcctgctggtgggcggcggcatcatgagc
tcgacgctcggcgtctggctgcacgaactccagcccaactggtcgatgacgatggtcgaa
cgcctcgacggcgtcgcgctggaaagctcgaacggctggaataacgccggcaccggccac
tcggcgctcgccgagctgaactacacgccggagaaggcggacggcaaggtcgacatctcg
aaggcgatcgagatcaacgagtcgttccagatctcgcgccagttctgggcgtggcaggtc
aagcaaggcgtgctgaagaatccgcactcattcatcaactccacgccgcacatgagcttc
gtgtggggcgacgacaacgtgcgcttcctgaagaagcgctacgaagcgctgcaggccagc
ccgctgttccgcgggatgcaatattcggaagactacgaccagatcaagcagtgggtgccg
ctgatgatggaaggccgcgaccgcaaccagaaggtggccgcgacgtggacgccgatcggc
accgacgtgaacttcggcgagatcacgcgccagttcgtcggctacctgaagacgcagccg
aacttcacgctgtcgctgtcgagcgaagtgcgcgagatcacgcgcaacgccgacggcacg
tggcacgtgtcgtgggtcaagctgcattccgacgaaccgccgcaatcggtcgacgcgaag
ttcgtgttcatcggcgcgggcggcggtgcgctgcacctgctgcaggcgtcgggcatcccc
gaggcgaaggactacggcgcattcccggtcggcggctcgttcctcgtgaccgacaacccc
gaagtcgtgaagcagcacctcgcgaaggcgtacggcaaggcgtcggtcggctcgccgccg
atgtcggtgccgcacctcgacacgcggatcattgacggcaagaagatcatcctgttcggg
ccgttcgcgacgttctcgaccaagttcctgaagaacggctcgtacttcgacctcgcgaag
agcaccaacctgcacaacgtcgcgccgatgatgcgcgtgggcgtcgacgaattcccgctg
gtgcagtacctcgccggccagctgatgctgaccgacgacgaccgcttcaacgcgctgaag
gaatacttcccgaacgcgaagaaggaagactggcgcctgtggcaggccggccagcgcgtg
cagatcatcaagcgcgacccggtcaagggcggcgtgctgaagctcggcaccgagatcgtc
gcgtcgcaggacggcagcatcgccggtctgctcggcgcgtcgccgggcgcatcgaccgcc
gcaccgatcatgctgaacctgatgcagaaggtgttcaaggacaaggtcgcgacgcccgag
tggcagcagaagatccgccagatcgtgccgagctacggcaccaagctgaacgacagcccg
gcgaaggtcgtcgaggaatggacctacacgagcgacgtgctgcaactgtcgccgccgccg
aagatcgacctcggcgcgccgtcgcaggccaccggcaacgcgccggcccgcccggcgaag
gcatcggccgacatggcgctgtaa

DBGET integrated database retrieval system