KEGG   Burkholderia cenocepacia HI2424: Bcen2424_3246Help
Entry
Bcen2424_3246     CDS       T00415                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
bch00010  Glycolysis / Gluconeogenesis
bch00020  Citrate cycle (TCA cycle)
bch00620  Pyruvate metabolism
bch01100  Metabolic pathways
bch01110  Biosynthesis of secondary metabolites
bch01120  Microbial metabolism in diverse environments
bch01130  Biosynthesis of antibiotics
bch01200  Carbon metabolism
Module
bch_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bch00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcen2424_3246
   00020 Citrate cycle (TCA cycle)
    Bcen2424_3246
   00620 Pyruvate metabolism
    Bcen2424_3246
Enzymes [BR:bch01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Bcen2424_3246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2 HlyD_D23 CAT
Motif
Other DBs
NCBI-ProteinID: ABK09991
Position
2:84758..86119
Genome map
AA seq 453 aa AA seqDB search
MKCLLLETNVRVTRIEVPDIGDYKNIPVIEVLVGVGQRVEREQSLVVLESDKATMDVPSP
TAGVIKEMKVAVGETVSQGTLIALLDSDGERQDDAAPVPPAASAARDLACPSANVATGLV
PALAPAPELNSASAPLHHAPAREGEPSRASHASPSVRKFARELGVDVARVSGSGPKGRIT
KDDITGFVKGVMSGQRAAPGAAAAPAGGGELNLLPWPKVDFAKFGPFEPKPLSRIKKISG
ANLHRNWVMIPHVTNNDEADITELEALRVQLNKEHEKAGVKFTMLAFVIKAVVAALKKFP
TFNASLDGDNLVFKQYYHIGFAADTPNGLVVPVIRDADKKGLVDIAKEMAELSKAARDGK
LKPDQMLGGCFSISSLGGIGGTHFTPIINAPEVAILGLSRGQMKPVWDGKQFVPRLTMPL
SLAFDHRVIDGAEAARFNAYLGALLADFRRIIL
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
ttgaaatgcttgctgttggagacgaatgtgcgggtgacacgaatagaagtgccggatatc
ggcgattacaagaacatccccgtgatcgaagttctggtgggagtcggacaacgcgtcgaa
cgggagcagtcgctcgtcgtgctcgagtcggacaaggcgacgatggatgtgcccagtccc
accgctggcgtgatcaaggagatgaaggtcgccgtcggcgagacggtgtcgcaaggcacg
ttgatcgcgctgctcgacagcgacggcgagcggcaggacgacgcggcgcctgtgcctccg
gccgcctcggctgcgcgcgatctcgcgtgtccgtcggcgaatgtcgcgacagggctggtg
ccggcgcttgcgccggcgcccgaactgaactccgcatccgcgccattgcatcacgcgccg
gcgcgcgaaggcgagccgtctcgcgccagccacgcatcgccgtcggtgcgcaagttcgcg
cgcgagctcggcgtcgacgtcgcgcgcgtgtcgggcagcggcccgaagggccgcatcacc
aaggacgacatcacgggcttcgtgaagggcgtgatgtcgggccagcgcgcggcgccgggc
gcggcagccgcgccggcaggcggcggcgagctgaacctgctgccgtggccgaaggtcgac
ttcgcgaagttcggcccgttcgagccgaagccgctgtcgcgcatcaagaagatctcgggc
gcgaacctgcatcgcaactgggtgatgatcccgcacgtcacgaacaacgacgaagcggac
atcaccgagctcgaagcgctgcgcgtgcagctgaacaaggagcacgaaaaggcgggcgtg
aagttcacgatgctcgcgttcgtgatcaaggcggtggtggccgcgctgaagaaattcccg
accttcaacgcgagcctcgacggcgacaacctggtgttcaagcagtactaccacatcggg
ttcgcggccgacacgccgaacggtctggtcgtgccggtgatccgcgatgcggacaagaag
ggcctcgtcgacatcgcgaaggaaatggccgagctgtcgaaggccgcgcgcgacggcaag
ctcaagcccgatcagatgctgggtggctgcttctcgatctcgtcgctcggcgggatcggc
ggcacgcacttcacgccgatcatcaacgcgccggaagtggcgatcctcgggttgtcgcgc
gggcagatgaagccggtgtgggacggcaagcagttcgtgccgcggttgacgatgccgctt
tccctggcgttcgatcatcgcgtgatcgatggcgccgaagccgcgcggttcaatgcttat
cttggcgcgttgctcgcggatttccgtcgcatcattctttga

DBGET integrated database retrieval system