KEGG   Burkholderia cenocepacia HI2424: Bcen2424_3317
Entry
Bcen2424_3317     CDS       T00415                                 
Name
(GenBank) type IV secretion system family protein
  KO
K03200  type IV secretion system protein VirB5
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
bch03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bch00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Bcen2424_3317
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bch02044]
    Bcen2424_3317
Secretion system [BR:bch02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   Bcen2424_3317
SSDB
Motif
Pfam: T4SS Flu_PA
Other DBs
NCBI-ProteinID: ABK10058
Position
2:153134..153841
AA seq 235 aa
MKRYLFTHVLMCAIVAGSASFIEPAKAEIYSVYDEKNVAQAIAMVGQLKQQVQQEMALYR
SMSGARGFGALLDRPGVVNALPGNWQRVYAAIREGGYAGLTGPAQALRAQSKLYDCEDQH
GIDQRICQRALNKPFQDKALGLQAYQTELAELDRIERLMRHIDTTRDPKGIAELQARIQS
ESVAVGNEMTKLQMFKMLAETEDRLIAEQQTELLLKRAGNTRRLQDQMVPITFGR
NT seq 708 nt   +upstreamnt  +downstreamnt
atgaagcgatacctattcacgcatgtactgatgtgcgccattgtcgcgggctcggcgtcg
tttattgagccggcgaaagcggaaatctattcggtctatgacgaaaagaacgtcgcccag
gcgatcgcgatggtcgggcagctcaaacaacaagtgcagcaggagatggcgttgtaccgc
tcaatgagcggcgcgcgcggctttggtgcgttgctggatagaccgggggtggttaatgcg
ttgccgggcaattggcaacgcgtgtatgcagcgattcgcgagggagggtatgccgggttg
actggtccggcccaggcgctgcgtgcgcaaagcaagctctacgactgtgaagatcagcat
ggcatcgatcagcgaatttgtcagcgtgcattaaacaagccatttcaggataaggcactt
ggcctgcaggcatatcagaccgagcttgccgaactcgaccggattgaacgtctgatgcgg
catatcgatacgacacgggatccgaagggtatcgcggagctgcaagcacgaatccagtcg
gagagtgtggcagtcggcaacgaaatgacgaagttgcagatgttcaagatgctcgcggaa
accgaggatcgcttgattgccgagcagcagactgaactgcttcttaagcgagcgggcaac
acgcggcgacttcaggatcagatggtgccgatcacgtttggtcgataa

DBGET integrated database retrieval system