KEGG   Burkholderia cenocepacia HI2424: Bcen2424_4438Help
Entry
Bcen2424_4438     CDS       T00415                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
bch00010  Glycolysis / Gluconeogenesis
bch00071  Fatty acid degradation
bch00350  Tyrosine metabolism
bch00625  Chloroalkane and chloroalkene degradation
bch00626  Naphthalene degradation
bch01100  Metabolic pathways
bch01110  Biosynthesis of secondary metabolites
bch01120  Microbial metabolism in diverse environments
bch01130  Biosynthesis of antibiotics
bch01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bch00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcen2424_4438
  Lipid metabolism
   00071 Fatty acid degradation
    Bcen2424_4438
  Amino acid metabolism
   00350 Tyrosine metabolism
    Bcen2424_4438
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Bcen2424_4438
   00626 Naphthalene degradation
    Bcen2424_4438
Enzymes [BR:bch01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Bcen2424_4438
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C TrkA_N 2-Hacid_dh_C Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: ABK11172
Position
2:complement(1387232..1388260)
Genome map
AA seq 342 aa AA seqDB search
MTQTMKAAVVHAFGEPLRIEEVPIPAPGPGQILVNIKASGVCHTDLHAADGDWPVKPSLP
FIPGHEGVGIVAAVGAGVTHVREGDRVGVPWLYTACGHCEYCCTGWETLCHGQQNTGYSV
NGSYAEYVLADPDYVGQLPAQVAFDEIAPILCAGVTVYKGIRVTDTRPGQWLAISGIGGL
GHVAVQYARAMGLHVAAIDISPDKLALARQLGAHLTIDASIDDPAKVIQKEIGGAHGVLV
TAVSRSAFAQALGMVRRGGTVALNGLPPGDFPLPIFSTVLNGITVRGSIVGTRRDLQESL
DFAADGLVRAHIHRDRLGNINDIFAKLREGKVDGRIVLTDMH
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgacccagaccatgaaagcggccgtggtacacgcgttcggcgagccgttgcgcatcgag
gaagtcccgatccccgcaccggggcccggccagattctcgtcaacatcaaggcgtcgggt
gtctgccataccgatctgcacgcggccgacggcgactggcccgtcaagccgtcgctgccg
ttcatcccgggccacgaaggcgtggggatcgtcgcggcggtcggcgcgggcgtcacgcac
gtgcgcgagggcgatcgcgtcggcgtgccgtggctctatacggcctgcggccattgcgag
tactgctgcacgggctgggaaacgctgtgccatgggcagcagaacaccggttattcggtg
aacggcagctacgcggaatacgtgctggccgatcccgattacgtcggccagttgcccgcg
caggtggcgttcgacgagatcgcgccgatcctgtgcgcgggtgtcacggtctacaagggc
attcgggtcaccgacacgcgcccgggccagtggctcgcgatttccggcatcggcggcctc
gggcacgtggccgtgcagtatgcgcgtgcgatgggcctgcacgtcgcggccatcgacatt
tctcccgacaagctcgcgctggcgcggcaactgggcgcccatctgacgatcgatgcgtcg
atcgacgaccccgcgaaagtgatccagaaggaaatcggcggcgcgcacggcgtgctcgtc
acggcggtatcgcgcagcgcgttcgcgcaggcgctcgggatggtccggcgcggcggcacg
gtggcgctcaatggtttgccgccgggcgatttcccgctgccgatcttctcgaccgtgctg
aacggcatcaccgtgcgcgggtcgatcgtcggcacgcggcgcgatctgcaggaatcgctc
gatttcgcggcggacggcctggtgcgcgcgcatatccaccgcgaccggctcggcaacatc
aacgacatcttcgcgaagctgcgggaagggaaggtcgacgggcgcatcgtgctgaccgac
atgcattga

DBGET integrated database retrieval system