KEGG   Burkholderia cenocepacia HI2424: Bcen2424_5368Help
Entry
Bcen2424_5368     CDS       T00415                                 

Definition
(GenBank) beta-ketoadipyl CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
bch00071  Fatty acid degradation
bch00072  Synthesis and degradation of ketone bodies
bch00280  Valine, leucine and isoleucine degradation
bch00310  Lysine degradation
bch00362  Benzoate degradation
bch00380  Tryptophan metabolism
bch00620  Pyruvate metabolism
bch00630  Glyoxylate and dicarboxylate metabolism
bch00640  Propanoate metabolism
bch00650  Butanoate metabolism
bch00900  Terpenoid backbone biosynthesis
bch01100  Metabolic pathways
bch01110  Biosynthesis of secondary metabolites
bch01120  Microbial metabolism in diverse environments
bch01130  Biosynthesis of antibiotics
bch01200  Carbon metabolism
bch01212  Fatty acid metabolism
bch02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bcen2424_5368
   00630 Glyoxylate and dicarboxylate metabolism
    Bcen2424_5368
   00640 Propanoate metabolism
    Bcen2424_5368
   00650 Butanoate metabolism
    Bcen2424_5368
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Bcen2424_5368
   00072 Synthesis and degradation of ketone bodies
    Bcen2424_5368
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bcen2424_5368
   00310 Lysine degradation
    Bcen2424_5368
   00380 Tryptophan metabolism
    Bcen2424_5368
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Bcen2424_5368
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bcen2424_5368
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Bcen2424_5368
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bch04147]
    Bcen2424_5368
Enzymes [BR:bch01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Bcen2424_5368
Exosome [BR:bch04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bcen2424_5368
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABK12101
Position
2:complement(2464303..2465505)
Genome map
AA seq 400 aa AA seqDB search
MTEAFLCDAIRTPIGRYGGALSGVRADDLGAVPLKALVERNRDVDWTAIDDVIYGCANQA
GEDNRNVARMSALLAGLPEGVPGSTINRLCGSGMDAVGVAARAIKSGEAALMVAGGVESM
TRAPFVMGKAASAFARQADIYDTTIGWRFVNPLMKQLHGVDSMPETAENVAVDYNVSRAD
QDLFALRSQQKAARAQQDGTLAEEIVSVTIAQKKGDPVVVSRDEHPRETSLEALAKLKGV
VRPDGSVTAGNASGVNDGAAALLLANEATAKRFGLTPRARVLGIATAGVAPRVMGIGPAP
ATQKLLARLGMTIDQFDVIELNEAFASQGLAVLRMLGVADDDPRVNPNGGAIALGHPLGA
SGARLVTTAMYQLHRTNGRFALCTMCIGVGQGIAIAIERV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagcttttctgtgtgatgcgatccgtacgccgatcgggcgttacggcggtgca
ctgtccggcgtgcgcgccgacgatctgggcgcggtgccgctcaaggcgctcgtcgagcgc
aatcgcgacgtcgactggacggcgatcgacgacgtgatctacggctgcgcgaaccaggcc
ggcgaggacaaccgcaacgtcgcgcgcatgtcggcgctgctcgcgggtttgccggagggc
gtgccgggttcgacgatcaaccgcctgtgcggttccggcatggatgcggtcggcgtggcc
gcacgcgcgatcaagtcgggcgaagccgcgttgatggttgcgggcggcgtcgagagcatg
acgcgcgcgccgttcgtgatgggcaaggccgcgagcgcgttcgcgcgccaggccgacatc
tacgacacgacgatcggctggcgcttcgtcaatccgttgatgaaacagctgcacggcgtc
gattcgatgccggaaaccgcggagaacgtcgcggtcgactacaacgtcagccgcgcggat
caggacctgttcgcgctgcgcagccagcagaaagccgcgcgggcgcagcaggacggtacg
ctggccgaagaaatcgtgtcggtcacgattgcgcagaagaagggcgacccggtggtcgtg
tcgcgcgacgagcatccgcgcgaaacgtcgctcgaagcgctcgcgaagctgaagggcgtc
gtgcgcccggatggctcggtcacggccggcaacgcgtcgggcgtgaacgacggcgccgcc
gcactgctgctggcgaacgaagcaaccgcgaagcgcttcggcctgacgccgcgtgcccgc
gtgctggggatcgcgacggccggcgtcgcgccgcgcgtgatgggcatcggcccggcgccg
gccacgcagaagctgctcgcgcggctcggcatgacgatcgaccagttcgacgtgatcgaa
ctgaacgaggcgttcgcgtcgcaaggtctcgccgtgctgcgcatgctcggcgtggccgat
gacgatccccgcgtgaacccgaacggcggcgcgatcgcgcttggccacccgctcggcgca
tcgggtgcgcgcctcgtgacgaccgcgatgtaccagctgcatcgcacgaacggtcgcttc
gcgctgtgcacgatgtgcatcggcgtcggtcagggcatcgcgatcgcgatcgaacgcgtg
tga

DBGET integrated database retrieval system