KEGG   Burkholderia cenocepacia HI2424: Bcen2424_5534Help
Entry
Bcen2424_5534     CDS       T00415                                 

Definition
(GenBank) Phospholipase C
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
bch00562  Inositol phosphate metabolism
bch00564  Glycerophospholipid metabolism
bch01100  Metabolic pathways
bch01110  Biosynthesis of secondary metabolites
bch02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Bcen2424_5534
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Bcen2424_5534
   00565 Ether lipid metabolism
    Bcen2424_5534
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Bcen2424_5534
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:bch02042]
    Bcen2424_5534
Enzymes [BR:bch01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     Bcen2424_5534
Bacterial toxins [BR:bch02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   Bcen2424_5534
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase DUF756
Motif
Other DBs
NCBI-ProteinID: ABK12267
Position
2:2640174..2642507
Genome map
AA seq 777 aa AA seqDB search
MTSRRKFLQQTAGSGLAAAALSAFPPSIRRALAIPAFHETGTIQDVKHVVLLMMENRAFD
SYFGTFKGVRGYGDRFAVPSPNGRDVFYQAYTKATPAATVTPYHLDARQGNAQRAGGTPH
TWADAQAAWDHGRMNRWPDAKTPLSMGYYDAAEVPFQRALADAFTLCDHYHCGMHTGTIA
NRLFYWSGTNGPNGISPADGSRVKIAALNNQFNGGNDIGPSSQGWTWTTYADRLQQAGVN
WKVYQSLIDNFGCNEMMSFRHWRAAIEQMPAARRPAYVASTDITQPVTAAGAFYDPAIDD
PLSPLAKGFGNTMPYGFLETFRDDIRNGKLPEVSWIIPPSAYSEHPGPSSPAQGGWYVQA
VLDALTANPEVWSKTVLLVNYDENDGFFDHMPSPAVPSRNADGTLAGGHTLSAADVAAEY
HDFAPATSSQPAVDGRPYGPGPRVPMWIVSPWSRGGWVNSQVFDHTSTLRFLEKRFGVAE
PQISAYRRAVCGDLTSAFNFRTPNNEPLPTLAGRTTKSQVDALSAAQQTAPKIVPPATPA
PPAQATGVRPSRALPYELHASARTDAGTGTVTLKFANTGRAAAVFHVYDKLHLDRLPRRY
VVEPGKRLHGDWAARADDGGKYDLWVLGPNGFHRRFTGDLSRLAGARAPHPEVRVGYAGA
SGNLHLRLRNDGGGTVRFTVKSNQAYGPLSGRGGNDDHGHGHGNENGNGHGTGTAWTVTV
RAGDQSELHWKLDSTGHWYDFIVTADSDASFSRRVAGRVETGRHSVSDPAMGLADRF
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcacgccgcaaattccttcagcagaccgccggttccggcctcgccgccgccgcg
ctctccgcgtttccgccgagcattcgccgcgcgctcgcgattcccgccttccacgaaacg
gggaccatccaggacgtcaagcacgtcgtgctgctgatgatggagaaccgcgcgttcgac
agctacttcggcacgttcaagggcgtgcgcggctatggcgaccgcttcgcggtgccgtcg
ccgaacggccgcgacgtgttctaccaggcgtacacgaaggcgacgcccgccgcgaccgtg
acgccgtatcacctcgacgcgcgccagggcaacgcgcagcgcgcgggcggcacgccgcac
acgtgggccgacgcgcaggccgcgtgggatcacggccggatgaaccgctggcccgacgcg
aagacgccgctgtcgatgggctattacgacgcagccgaagtgccgttccagcgcgcgctc
gccgatgcgttcacgctgtgcgaccactaccactgcgggatgcacacgggcacgatcgcg
aaccgcctgttctactggagcggcaccaacggcccgaacggcatcagcccggccgatggc
agccgcgtgaagatcgccgcgctgaacaaccagttcaacggcggcaacgacatcggcccg
tcgagccagggctggacctggacgacctatgccgaccggctgcaacaggccggcgtgaac
tggaaggtctatcagagcctgatcgacaacttcggctgcaacgagatgatgagcttccgc
cactggcgcgctgcgatcgagcagatgccggccgcgcgccggcccgcgtacgtcgcgtcg
accgacatcacgcagccggtgacggcggccggcgcgttctacgatccggcgatcgacgat
ccgctgagcccgctcgcgaagggcttcggcaacacgatgccgtacggctttctcgaaacg
ttccgcgacgacatccgcaacggcaagctgccggaagtgtcgtggatcatcccgccgtcc
gcgtacagcgaacacccggggccgtcgagccccgcgcagggcggctggtacgtgcaggcc
gtgctcgacgcgctgacggcgaacccggaggtctggagcaagaccgtgctgctggtgaac
tacgacgagaacgacggcttcttcgaccacatgccgtcgccggccgtgccgtcgcgcaac
gccgacggcacgctcgcgggcggccatacgctgtcggccgccgacgtcgcggccgagtac
cacgacttcgcgccggccacgtcgagccagccggccgtcgatggccgtccgtacggcccg
ggcccgcgcgtgccgatgtggatcgtgtcgccgtggagccgcggcggctgggtcaactcg
caggtgttcgaccatacgtcgacgctgcgcttcctggagaagcgcttcggcgtcgcggag
ccgcagatcagcgcgtaccgccgcgcggtgtgcggcgacctgacgagtgcgttcaatttc
cgcacgccgaacaacgagccgctgccgacgctcgcgggccgcacgacgaaaagccaggtc
gacgcgctgagcgccgcgcagcaaaccgcgccgaagatcgtgccgcccgccacgcccgcg
ccgcccgcacaggcgaccggcgtacgtccgtcgcgcgcgctgccgtacgaactgcacgcg
agcgcgcgcaccgatgccggcaccggcaccgtcacgctgaagttcgcgaacaccggccgc
gccgccgccgtgtttcacgtctacgacaagctgcacctcgaccggctgccgcggcgctac
gtcgtcgagcccggcaagcggctgcacggcgactgggccgcgcgtgccgacgatggcggt
aaatatgacctgtgggtgctcggcccgaacggctttcaccgccgcttcaccggcgacctg
agccgcttggccggggcgcgcgcgccgcatccggaagtgcgcgtcggctatgcgggcgcg
agcggcaacctccacctgcggctgcgcaacgacggcggcggcacggtgcgcttcacggtg
aagtcgaaccaggcctacgggccgctgtccgggcggggcgggaacgacgaccacggtcat
ggccacggcaacgaaaacggcaacggccatggcaccggcaccgcatggaccgtcacggtg
cgcgccggcgaccagtccgaactgcactggaagctcgactcgaccggccattggtacgac
ttcatcgtcaccgccgacagcgacgcgagcttctcgcgccgcgtggccggccgcgtggaa
accggccgccactcggtcagcgacccggcgatggggctcgccgaccgcttctga

DBGET integrated database retrieval system