KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6219Help
Entry
Bcen2424_6219     CDS       T00415                                 

Definition
(GenBank) gamma-glutamyltransferase 1, Threonine peptidase, MEROPS family T03
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
bch00430  Taurine and hypotaurine metabolism
bch00460  Cyanoamino acid metabolism
bch00480  Glutathione metabolism
bch01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bch00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Bcen2424_6219
   00460 Cyanoamino acid metabolism
    Bcen2424_6219
   00480 Glutathione metabolism
    Bcen2424_6219
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bch01002]
    Bcen2424_6219
Enzymes [BR:bch01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     Bcen2424_6219
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     Bcen2424_6219
Peptidases and inhibitors [BR:bch01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   Bcen2424_6219
CD molecules [BR:bch04090]
 Proteins
  Bcen2424_6219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: ABK12951
Position
3:385261..387246
Genome map
AA seq 661 aa AA seqDB search
MNRTAIFPYASALLAAALLTACGGDVENEAARTTAPSTDASCLAVDNSGATVVVGSNQPG
DPSLPEASSGYRTGMKPVYAKTYLVATSNAYASAAGCAVLKKGGTAADAAVAVQAVLGLT
VPEATGLGSGGVLLYYDARGKTVQAYDGRETAPAAATENYLRYVDDATDHSAPLPNARAS
GRSIGTIGVPRLIEALQQDHGRLPWQSLFGDAITLATNGFPIGGRLADAIAANAANLKRD
PEAAAYFLNADGSPKTLGTVLKNPAYARTLSLMAQSGANALYTGQIAQDIVAKIAATKGA
DGSTLTPGKTTVADLAAYQAKRREPVCTTYRSYWVCGMPPPSSGGIAVASALGILENFDL
KSLKPTAIDLEGGKPTVAGVHLVTEAERLAYADRDKYVADTDFVPLPGGTWDTLLNKPYL
KSRAALIDTTKSMGTAQPGNLGAVPLGVDTTLIEHGTNQFTIVDGDGNVLSATTTVESSM
GSFHMTNGFLLNNQLTDFSANPLDTSGNPVANRLQPGKRPRSSMAPTIVFGQAADGSRGD
FVMATGSPGGGTIPQYVVKTLVGALDWGLDAQQSAGLVDFGASNSPTTTIGGEHPNVNAA
NNGANDPLITGLLALGHKVSTSAQASGVNTVMRVTVGQSPALQGGTDPRREGVVLGDTFR
P
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaacagcgatttttccgtatgcgtccgcgttgctcgcggctgccctgttgacc
gcctgcggcggcgacgtcgaaaacgaggcggcccgcacgaccgcaccgtccaccgatgcg
agctgcctcgcggtcgacaacagcggcgcgacggtcgtggtgggctcgaaccagccgggc
gacccgtcgctgccggaagcgtcgtcgggctatcgcaccgggatgaagcccgtctatgcg
aaaacgtacctggtggccacgtcgaacgcgtacgcgagcgcggccggttgcgcggtgctg
aagaagggcggcacggccgccgacgcggcggtcgccgtgcaggccgtgctcggtctgacc
gtccccgaggcgacgggtctcgggtcgggcggcgtgctgctctactacgatgcgcgcggc
aagacggtgcaggcatacgacggccgcgaaaccgcgccggccgccgccaccgagaactac
ctgcgctacgtcgacgatgccaccgatcattcggcgccgctgccgaacgcgcgcgcgagc
ggccgctcgatcggcacgatcggcgtgccgcggctcatcgaggcgctgcaacaggatcat
ggccgcctgccgtggcagagcctgttcggcgacgcgatcacgctggcgaccaacggtttc
ccgatcggcggccggctggccgacgcgatcgcggcgaacgccgcgaacctgaagcgcgac
cccgaagccgccgcgtatttcctgaacgccgacgggtcgccgaagacgctcggcaccgta
ctgaagaatcccgcctacgcgcgcacgctgtcgctgatggcgcagtcgggcgcgaacgcg
ctgtacaccgggcagatcgcgcaggacatcgtcgcgaagatcgcggcgaccaagggcgcg
gacggctcgacgctcacgccgggcaagacgaccgtcgccgatctggccgcgtatcaggcg
aagcgccgcgaaccggtgtgcacgacctatcgcagctactgggtgtgcgggatgccgccg
ccgtcgtcgggcggtatcgcggtcgcatcggcgctcggcattctcgagaacttcgacctg
aagtcgctgaagccgacggcgatcgatctcgaaggcggcaagccgaccgtcgcgggcgtt
cacctcgtcaccgaggccgaacggctcgcgtatgcggaccgcgacaagtacgtggccgat
accgacttcgtgccgctgccgggcggcacgtgggacacgttgctgaacaagccgtacctg
aaatcgcgcgcggcgctgatcgacacgaccaagagcatgggcaccgcgcagcccggcaat
ctcggcgcggtgccgctcggcgtcgacacgacgctgatcgagcacggcacgaaccagttc
acgatcgtggacggcgacggcaacgtgctgagcgcgacgacgacggtcgagtcgagcatg
ggctcgttccacatgaccaacggcttcctgctgaacaaccagttgaccgacttctccgcg
aatccgctcgacacgtccggcaatccggtggccaaccgcctgcagccgggcaagcgaccg
cgcagctcgatggcgccgacgatcgtgttcgggcaggccgccgacggttcgcgcggcgac
ttcgtgatggcgaccggctcgccgggcggcggcacgattccgcaatacgtggtcaagacg
ctggtcggcgcgctcgactgggggctcgacgcgcagcagtcggcgggcctcgtcgacttc
ggcgcgagcaacagcccgaccaccacgatcggcggcgagcatccgaacgtcaacgcggcg
aacaacggcgcgaacgatccgctgatcacggggctgctcgcgctcgggcacaaggtgtcg
acgtccgcgcaggcgagcggcgtcaacacggtgatgcgcgtgacggtcggccagtcgccg
gcgttgcagggcggcaccgatccgcgtcgcgaaggcgtcgtgctcggcgatacgttccgg
ccgtaa

DBGET integrated database retrieval system