KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6477Help
Entry
Bcen2424_6477     CDS       T00415                                 

Definition
(GenBank) RNA polymerase, sigma 54 subunit, RpoN/SigL
  KO
K03092  RNA polymerase sigma-54 factor
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
bch02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bch00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Bcen2424_6477
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bch03021]
    Bcen2424_6477
Transcription machinery [BR:bch03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     Bcen2424_6477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma54_DBD Sigma54_CBD Sigma54_AID HTH_23 HTH_38 HTH_IclR
Motif
Other DBs
NCBI-ProteinID: ABK13207
Position
3:689747..691180
Genome map
AA seq 477 aa AA seqDB search
MPVSLALQMRQHLALTPRLQQSLRLLQLSSLEFQQELRQALDMNPFLEDGQGDEDTVAGT
PEQPTEAAAPEAAPEHDDIRPPDGEVPFTAAPAPRGTSRQGDDTDGLSPGEWIAAEPSLH
QQLHDALRLYPLNKRDREAARLVIDALDDDGYLRQELPELLVAADPAWLLSEQDLAVALR
LVQMLDRPGIAARSLSECLVLQLDAIPAGTPALAEAKAIAREHLERLARRETAEIQRRLG
CNQQTLHAACALVRGLDPRPGNHYGSTRGDYVVPDVIVRQVRDEWIVTINPAVLPRARLH
ERYATLFAQSSGERDSPLGQQLQEARWLIRNVQKRFDTIQRVGECIVARQRDFFRYGEIA
MKPLVLRDIAEELDLHESTVSRATGNKYMATPHGTFEFKHFFPRKLEAAGKGVCSASAAK
VLIRDMIAAERQTDPLSDVALAENLAGRGILLARRTVTKYRQAMKIPPADLRRRDAA
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtctcgcttgcgctgcagatgcgacagcatctcgcacttacgccgaggcttcag
cagtcgctgcggctgctgcagttgtcctcgctggagtttcaacaggaattgcgtcaggcg
ctcgacatgaacccgtttctcgaagacggccagggcgacgaggacaccgttgccggcacg
cccgagcagccgaccgaagcggccgcgcccgaagcggcgcccgagcacgacgacattcgc
ccgccggatggcgaggtgccgtttaccgcggcgcccgcgccgcgcggcacgagccgtcag
ggcgacgataccgacggcctgtcgcccggcgaatggatcgccgccgagccgtcgctgcat
cagcaactgcacgatgcgctgcggctctatccgctcaacaagcgcgaccgcgaagccgcg
cgcctcgtgatcgatgcgctggacgacgacggctacctgcgtcaggaactgcctgaactg
ctggtcgccgccgatcccgcgtggctgctgtcggagcaggatctcgcggtcgcgctgcgg
ctcgtgcagatgctcgaccggccgggtatcgcggcccgttcgttgtccgaatgcctggtg
ttgcagctcgacgcgattccggccggcacgccggcgctcgcggaagcgaaggcgatcgcg
cgcgagcatctggagcggctcgcgcgccgcgagacggccgagatccagcgacgcctcggc
tgcaaccagcagacgctgcacgcggcctgcgcgctggtgcgcgggctcgacccgcgcccg
ggcaatcactacggcagcacgcgcggcgactacgtggtgcccgacgtgatcgtgcgtcag
gtgcgcgacgaatggatcgtcacgatcaatccggccgtgctgccgcgcgcccgcctgcac
gagcgctatgcgacgctgttcgcgcagtcgagcggcgagcgcgattcgccgctcggccag
cagttgcaggaagcgcgctggctgatccgcaacgtgcagaagcgtttcgacacgattcag
cgcgtgggcgaatgcatcgtcgcgcggcagcgcgatttcttccgctacggcgagatcgcg
atgaagccgttggtgctgcgcgacatcgcggaagagctcgacctgcacgaatcgaccgtc
tcgcgcgcgaccggcaacaagtacatggccacgccgcacggcacgttcgagttcaagcat
ttcttcccgcgcaagctggaagcagccggcaagggcgtgtgttcggcgtcggccgcgaag
gtgctgatccgcgacatgatcgcggccgagcggcagaccgatccgctgtccgacgtcgcg
ctcgcggagaacctcgcgggccgcggcatccttcttgcgcgccgcacggtgaccaagtat
cgccaggcgatgaagattccgccggccgacttgcggcgccgcgacgccgcgtga

DBGET integrated database retrieval system