KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6484Help
Entry
Bcen2424_6484     CDS       T00415                                 

Definition
(GenBank) sodium/proton antiporter, CPA1 family
Organism
bch  Burkholderia cenocepacia HI2424
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Na_H_Exchanger
Motif
Other DBs
NCBI-ProteinID: ABK13214
Position
3:complement(698273..699595)
Genome map
AA seq 440 aa AA seqDB search
MHETLWYLIIGAVLLGMGVVTSALRHLPCSSAMIYLVLGVALGPAGAGLLHLDLERDGQL
LREIVEVALLVSLFAIGLRLRVPLSDKLWLVPCRLGLLAMIVTVPLLAACAVLALGLGWG
PALLLAAILAPTDPVLAHDVQVHDPGDRDLVRFALSGEGGMNDGIALPFALAGLALCGAP
GATHGIPPLSGTFALVALWGIAGAAAIGGGLGWATTKTIGWLRTRHAQALGLEGFFALAL
IVLSFGAAQLAHTFGFIATFAAGVAMRRVEHRASGDRPPREVIGQIDSEDVVATEKHPEK
AHAFMAESVLGFTIELERIAEAIVMTMIGSVLSTLPGPLLTWGAVALAAVLFVAVRPLAV
LVTLAGSRATHAQRRLMAWFGIRGIGSFYYLLFALEHGPSDVVRPLAAPVLAVVSASVVA
HGISATPLMNWYYRLQQHRR
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgcacgaaaccctctggtatctgatcatcggcgccgtgctgctgggcatgggcgtcgtg
acgtccgcgctgcgccacctgccctgcagctcggcgatgatttacctggtgctcggcgtc
gcgctcggtccggccggcgccggcctgctgcatctcgacctcgaacgcgacgggcaactg
ctgcgcgagatcgtcgaagtcgcgctgctcgtgtcgctgttcgcgatcgggctgcggctg
cgcgtgccgctgtccgacaagctgtggctcgtgccgtgccgcctcgggctgctcgcgatg
atcgtcaccgtgccgctgctcgccgcgtgcgcggtgctcgcgctgggccttggctggggc
cccgcgttgctgctcgcggcgatcctcgcgccgaccgaccccgtgctcgcgcacgacgtg
caggtgcacgatccgggcgatcgcgacctggtgcgcttcgcgttgtccggcgaaggcgga
atgaacgacggcatcgcgctgccgttcgcgctcgcggggctcgcgctgtgcggcgcaccg
ggtgcgacgcacggcatcccgccgctgtccggcacgttcgccctcgtcgcgctgtggggc
atcgcgggcgcggccgcgatcggcggcgggctcggctgggccacgacgaagacgatcggc
tggctgcgcacgcggcacgcgcaggcgctcggcctcgaaggcttcttcgcgctcgcgctg
atcgtgctgtcgttcggcgccgcgcagctcgcgcacacgttcggcttcatcgcgacgttc
gcggccggcgtcgcgatgcggcgcgtcgagcatcgcgcgagcggcgaccgcccgccgcgc
gaagtgatcggccagatcgattcggaagacgtggtcgcgaccgagaagcatccggagaaa
gcgcatgcgttcatggccgaatcggtgctcggcttcacgatcgagctcgaacggatcgcc
gaagcgatcgtgatgacgatgatcggcagcgtgctctcgacgctgcccggcccgctgctc
acgtggggcgccgtcgcgctggccgccgtgctgttcgtcgccgtgcgtccgctcgcggtg
ctggtcacgctggccggctcgcgcgcgacgcatgcgcagcggcggctgatggcgtggttc
ggcatccgcgggatcggctcgttctactacctcctgttcgcgctcgagcacgggccgtcc
gacgtcgtgcgcccgctcgcggcgccggtgctggccgtggtgtccgcgtcggtggtcgcg
cacgggatttccgcgacgccgctgatgaactggtactaccggttgcagcagcatcggcgc
tga

DBGET integrated database retrieval system