KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6501Help
Entry
Bcen2424_6501     CDS       T00415                                 

Definition
(GenBank) Endonuclease/exonuclease/phosphatase
Organism
bch  Burkholderia cenocepacia HI2424
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exo_endo_phos
Motif
Other DBs
NCBI-ProteinID: ABK13231
Position
3:complement(723247..724038)
Genome map
AA seq 263 aa AA seqDB search
MALSKQPAPAPHVVTADAAPAAAPGGRDLRIATYNIHGGYGAWSARAVDRIAAVIDELDA
DVIALQEVPLGGTRAPDVLAHLRDATGMHAAAGPTIDTPERRYGNAVLSRCPIRAARTLD
LSFHPREPRGALDADIDCSTGPIRVVATHLGLSASERSAQVQRLLAAFDTGAMPVILLGD
INEWFVRGRALQALVTRFRRAPAPRTFPTVCPVFSLDRIWIHPGELLVDVVVHRSARARH
ASDHYPLVARMRSTPATGTALAL
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgagcaaacaaccggccccggcgccgcacgtcgtcaccgccgacgcggcgccc
gccgccgcgccgggcgggcgcgacctgcggatcgcgacctacaacatccacggcggctac
ggtgcgtggtcagcgcgtgcggtcgaccggatcgcggccgtgatcgacgaactcgacgcg
gacgtgatcgcgctgcaggaagtgccgctcggcggcacacgcgcgccggacgtgcttgcg
cacctgcgcgacgcgaccggcatgcacgcggcggccggcccgacgatcgacacgcccgag
cgccgctacggcaacgcggtgctgtcgcgctgcccgatccgcgcggcgcgcacgctcgac
ctgtcgttccacccgcgcgagccgcgcggcgcgctcgacgccgacatcgactgcagcacg
ggcccgatccgcgtggtcgcgacccatctcgggctgtcggccagcgaacgcagcgcgcag
gtgcagcggctgctcgcggcattcgatacgggcgcgatgccggtgatcctgctcggcgac
atcaacgaatggttcgtgcgcggccgcgcgctgcaggcgctcgtcacgcggttccggcgt
gcgccggcgccgcgcacgttcccgaccgtgtgcccggtgttctcgctcgaccggatctgg
attcatccgggcgagctgctggtcgacgtggtcgtgcaccgcagcgcgcgggcgcggcac
gcgtcggaccactacccgctggtggcgcggatgcgttcgacgcccgcgacgggcacggcg
cttgcgctgtga

DBGET integrated database retrieval system