KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6504Help
Entry
Bcen2424_6504     CDS       T00415                                 

Definition
(GenBank) MgtC/SapB transporter
  KO
K07507  putative Mg2+ transporter-C (MgtC) family protein
Organism
bch  Burkholderia cenocepacia HI2424
Brite
KEGG Orthology (KO) [BR:bch00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bch02000]
    Bcen2424_6504
Transporters [BR:bch02000]
 Other Transporters
  Others
   Bcen2424_6504
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MgtC DUF979
Motif
Other DBs
NCBI-ProteinID: ABK13234
Position
3:complement(726544..727248)
Genome map
AA seq 234 aa AA seqDB search
MHIMIGHLELLGRLLLAALLGSVIGLERERLNWAAGLRTHMLVCVGSALVMLVSTFGFED
VRGQNGVVLDPSRVAAQVVSGIGFLGAGSILLRGEVVRGLTTAASLWAVAGVGLAAGGGM
VVASVGATAIVLAILAGVKPLERRFIAQRQQRTLQLVAERGGLTLGTLHEALGPGRVRVK
RFIVQQSDDDPDTDDISVSFSRTSGPEFAAICETLQNIACVRTCQPDTSSRSFV
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgcacatcatgatcggccacctcgaattactcggacgcctgctgctggccgcgctgctc
ggcagcgtgatcgggctcgaacgcgaacgcctcaactgggccgccgggctgcgcacgcac
atgctcgtgtgcgtgggctccgcgctcgtgatgctggtgtcgacgttcggcttcgaggac
gtgcgcgggcagaacggcgtcgtgctcgatccgtcgcgggtcgccgcgcaagtggtgtcc
ggcatcggctttctcggcgcgggctcgatcctgctgcgcggcgaagtggtgcgcgggctg
acgacggccgcgagcctgtgggcggtggccggcgtcgggctcgccgcgggtggcggcatg
gtggttgcgtcggtcggcgcgacggcgatcgtgctcgcgatcctcgcgggcgtgaaaccg
ctcgagcgccgcttcatcgcgcagcgccagcagcgcacgctgcagctcgtggccgagcgc
ggcggcctcacgctcggcacgctgcacgaggcgctcggccccggccgggtgcgcgtgaaa
cggttcatcgtccagcaatcggacgacgatccggacaccgacgacatctccgtctcgttc
tcgcgcacgagcgggccggaatttgcggcgatctgcgagacgctgcaaaacatcgcgtgc
gtacggacctgtcaacccgacacctcgtcaaggagtttcgtgtga

DBGET integrated database retrieval system