KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6506Help
Entry
Bcen2424_6506     CDS       T00415                                 

Definition
(GenBank) succinate dehydrogenase subunit B
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
bch00020  Citrate cycle (TCA cycle)
bch00190  Oxidative phosphorylation
bch00650  Butanoate metabolism
bch01100  Metabolic pathways
bch01110  Biosynthesis of secondary metabolites
bch01120  Microbial metabolism in diverse environments
bch01130  Biosynthesis of antibiotics
bch01200  Carbon metabolism
Module
bch_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bch_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bch_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bch00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bcen2424_6506
   00650 Butanoate metabolism
    Bcen2424_6506
  Energy metabolism
   00190 Oxidative phosphorylation
    Bcen2424_6506
Enzymes [BR:bch01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Bcen2424_6506
    1.3.5.4  fumarate reductase (quinol)
     Bcen2424_6506
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4_18
Motif
Other DBs
NCBI-ProteinID: ABK13236
Position
3:727752..728459
Genome map
AA seq 235 aa AA seqDB search
MSDPRTLHIYRYDPDRDAAPYMQRYEIDVNPDDRMLLDVLGRVKCDDETLSYRRSCREGI
CGSDAMNINGKNGLACLTNMQTLPREIVLRPLPGLPVVRDLIVDMTDFFNQYHSIRPYLI
NDTTPPARERLQSPEERDQLDGLYECILCACCSTSCPSYWWNPDKFVGPAGLLQAYRFIA
DSRDLATAERLDDLEDPYRLFRCRTIMNCTDVCPKGLNPTKAISEIRTMLVRRTV
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatccgcgcaccttgcatatctatcgctacgaccccgaccgcgacgcggcgcct
tacatgcagcgctacgagatcgacgtgaatccggacgaccgcatgctgctcgacgtgctg
ggccgcgtgaagtgcgacgacgagacgctgtcgtatcggcgctcctgccgcgaaggcatc
tgcggctcggacgcgatgaacatcaacggcaagaacggcctcgcatgcctgaccaacatg
cagacgctgccgcgcgaaatcgtgctgcggccattgccggggctgccggtggtgcgcgac
ctgatcgtcgacatgaccgatttcttcaaccagtaccactcgatccggccatacctgatc
aacgacacgacgccgcccgcgcgcgagcggctgcaatcgccggaggagcgcgaccagctc
gacgggctgtacgaatgcatcctgtgcgcgtgctgttcgacgtcgtgcccgagctactgg
tggaacccggacaagttcgtcggtcccgccgggctgctgcaggcgtatcgcttcatcgcc
gattcgcgcgatctcgcgacggccgagcggctcgacgatctcgaggacccgtaccggctg
ttccgctgccggacgatcatgaattgcacggacgtgtgcccgaaggggctgaatccgacc
aaggcgatttcggagatccggacgatgctggtcaggcggacggtgtga

DBGET integrated database retrieval system